CAZyme Information: MGYG000001533_00887

Basic Information

• Species: Corynebacterium ammoniagenes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium ammoniagenes
• CAZyme ID: MGYG000001533_00887
• CAZy Family: GT4
• CAZyme Description: D-inositol-3-phosphate glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1511		169568.77	6.3658

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001533	2790185	Isolate	not provided	not provided

• Gene Location: Start: 921837; End: 926372 Strand: +

Full Sequence      

MHADEYRDLDSIRRLRLAEAIKDSDSISNQSEPRSGLTQGSSLKQLKAERDELERQVRSA
RVALEELQSENNRLNNQRALAEQRLKSVRESRTFLVGKAATAPFQAVRRAINDPRLKSMR
IDEKLKTSLRKSRYILRESRERLEKSSVGSGDYFKSRTENSDLDGVPTDISVDSRANRGE
GSSPVDIYEKKPSVRTFERAMKHLWFTEGKLLSAKAFIENSPQYVEKLGDISKSLANRIL
GEARIDPSQIVPERSPYPAYVAEPGRIMYCVHQSPVYNSNGYSTRTRGVASGLNAGAGDV
VVVARSGYPWDSSVDIEKPKSVRSVSILDGVQYVHLPGGNLNRDPIDQYVLQCADAFVRE
ARMIRPSIIQSASNYKTALPALIAARRLGIPFVYEVRGFWEITEASANSGFQETERFESM
RSLETFVAQNADRLLAITSQVRDELIVRGIDPEIVEVSPNSVDPEIFLPLPKDIEYSQSK
GIRIDAPVIGFAGSIVGYEGLDLLVEASRLLSTKGVDHQVVIAGSGAAEQDLKEQVTKLA
LDSQVLLLGRLPQDEMPRLHSTFDIVVCPRRANLVTELVSPLKPLESFATGKATVLSNVA
PNRDLAGEDEERALLCDADDAASLARQLEKLILNADLRADFGRTARLWVVSERSWASLGK
SMLDAHKHALEDAEKKILGAKPLHTLRVGVIGDEFTRSALEDAFNVEWLSRKNWESQLDS
APNFDLIFVESAWEGNGGEWWRGVGHYSDEESTDLRSLLAVAREKDIPSVFWNKEDPIHF
SRFAPNAAFFDHVFTTDANMIPRYINAQDSYNKTVSALPFFAQPKLHNPMPSTREFRETV
AYAGSYYGDRFKERSEALERLLAASVQYGLDIYDRQANNPDSSYKFPQIYRSAVRGGLQY
RETVESYKSHIAHLNVNSVFDSPTMFSRRVVEIPACGGIVMSAKGRGITETLGSNIAHSD
DPEDHRAWLHGWTTNPVERLEEIWRQMRTVYRSHTTETALSILARTAGISVEGIKPVEYT
AVLEDLAMLSPAERLKHIEHVASQSVRPRSVKISDLGEEEAAFVKKYGIQVMLVDDFSAS
HDIEVHFPKRFSRTFAEDVLLPLRFGEFSSIFVRSKQHYENISPVLEPTFSEKPREQLLA
VNNRQSTAVASVIIELPGVSEQSESAPSLETEITDIEGKTVLVAGHDLKFAEPIIEKLHG
SGCKVLIDKWEGHNRHDSYQSKVLLGQADIVFCEWGLGNAVWYSKNLHAHQSLVIRVHSQ
ELFLPFLKQIRQSSVSKFIFVGELVRKAAIESHGILGEKSVVIPNFVDTSKFAKPKDDTA
RKTLGIVGIVPRSKRIDRALDVLEGLLEQDPTYKLRIKGKVPEDYPWLRKRPDEMDFYSN
QYSRIISLNEKWPGAVIFDSFGHDMEEWYRLVGIVLSTSDFESFHLTLADGASSGAMPVS
LNWPGADLIYPLSWLFATTEDMVNSILNQTFNVQDAQKFVEINFKQSDLLNRFVKLLVIG
HRERGTSARNP

Enzyme Prediction     

No EC number prediction in MGYG000001533_00887.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	485	640	4.2e-19	0.93125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	2.74e-41	378	658	112	386	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	9.30e-40	266	664	1	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.73e-33	266	664	1	372	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	4.49e-31	335	669	53	376	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
cd03800	GT4_sucrose_synthase	3.72e-26	304	657	35	391	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS73278.1	0.0	1	1511	1	1511
APT94562.1	0.0	1	1497	1	1517
BCB34137.1	0.0	1	1482	1	1489
ANR64417.1	0.0	1	1482	1	1489
ANR61417.1	0.0	1	1482	1	1489

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3OKA_A	9.53e-07	459	662	169	372	Crystalstructure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum],3OKA_B Crystal structure of Corynebacterium glutamicum PimB' in complex with GDP-Man (triclinic crystal form) [Corynebacterium glutamicum]
3OKC_A	9.93e-07	459	662	169	372	Crystalstructure of Corynebacterium glutamicum PimB' bound to GDP (orthorhombic crystal form) [Corynebacterium glutamicum],3OKP_A Crystal structure of Corynebacterium glutamicum PimB' bound to GDP-Man (orthorhombic crystal form) [Corynebacterium glutamicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D3Q051	4.51e-09	381	671	139	429	D-inositol 3-phosphate glycosyltransferase OS=Stackebrandtia nassauensis (strain DSM 44728 / CIP 108903 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) OX=446470 GN=mshA PE=3 SV=1
O05083	8.65e-07	478	647	173	335	Uncharacterized glycosyltransferase HI_1698 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1698 PE=3 SV=1
Q65CC7	9.91e-07	485	667	206	382	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
Q8NNK8	5.22e-06	459	662	169	372	GDP-mannose-dependent monoacylated alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pimB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001533_00887.