CAZyme Information: MGYG000001533_01318

Basic Information

• Species: Corynebacterium ammoniagenes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium ammoniagenes
• CAZyme ID: MGYG000001533_01318
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000001533_1|CGC11	38360.06	4.783

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001533	2790185	Isolate	not provided	not provided

• Gene Location: Start: 1396998; End: 1398065 Strand: +

Full Sequence      

MHTINRIGRAVTKKITTLLTAVVVGTGLASCAEFPSRGETSSLSEEGSANMDSHPTTEAD
TKDLGLPTSAPLVGPEPGKSSIINLASGRKFILHMPASYQPGKKWPVVLAFHGWKETAGM
MEGYTEMDAAEAIMVYPYGKDGAWAPAPYAKTTGTEDIQFARDIVDSLRATYAVDDDRIF
ATGMSNGGGFAAYLGCQMPDVFTSVATVSAAYYKPIHESCKDEPVGRLDMHGTLDPVVGY
YGGTRHKEPYESVPDVVTLDAKRNRCEGELTTERLANNALLIQWELCEDPVQHIRIGGGR
HVWPGGTYDNASEVGKGFATDKVLDFFAIPGRPADMEEAHTVETGTLDENEFSQK

Enzyme Prediction     

No EC number prediction in MGYG000001533_01318.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	88	218	7.5e-25	0.5903083700440529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3509	LpqC	1.01e-37	88	332	46	309	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
TIGR01840	esterase_phb	2.30e-12	93	213	3	131	esterase, PHB depolymerase family. This model describes a subfamily among lipases of the ab-hydrolase family. This subfamily includes bacterial depolymerases for poly(3-hydroxybutyrate) (PHB) and related polyhydroxyalkanoates (PHA), as well as acetyl xylan esterases, feruloyl esterases, and others from fungi. [Fatty acid and phospholipid metabolism, Degradation]
COG4099	COG4099	2.95e-08	90	238	175	329	Predicted peptidase [General function prediction only].
pfam00756	Esterase	7.14e-08	89	209	8	142	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG0400	YpfH	1.09e-07	101	252	14	174	Predicted esterase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUX40426.1	1.13e-22	65	238	232	398
AUX29931.1	2.14e-22	65	271	236	425
ALO15718.1	3.24e-22	72	328	18	287
CAN90905.1	7.36e-22	65	243	237	408
AGP34778.1	3.44e-21	65	243	239	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WYD_A	4.14e-07	80	209	12	141	C-terminalesterase domain of LC-Est1 [uncultured organism],3WYD_B C-terminal esterase domain of LC-Est1 [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1CC33	3.64e-19	70	327	26	269	Probable feruloyl esterase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=faeC-2 PE=3 SV=1
Q9Y871	1.89e-15	89	302	292	519	Feruloyl esterase B OS=Piromyces equi OX=99929 GN=ESTA PE=2 SV=1
Q5B2G3	4.27e-15	69	327	23	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
A2QYU7	3.16e-13	69	250	23	205	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
B8YG19	7.47e-10	87	301	56	263	Bifunctional acetylxylan esterase/xylanase XynS20E OS=Neocallimastix patriciarum OX=4758 GN=xynS20E PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000036	0.001783	0.998189	0.000003	0.000002	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001533_01318.