CAZyme Information: MGYG000001533_02297

Basic Information

• Species: Corynebacterium ammoniagenes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium ammoniagenes
• CAZyme ID: MGYG000001533_02297
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		44448.26	8.4476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001533	2790185	Isolate	not provided	not provided

• Gene Location: Start: 2461459; End: 2462673 Strand: +

Full Sequence      

MKKFWGTTSLAIALGAFAVWAILRIHNFDGPHALVWRVPLDLHIYVLAGLDIVDGGLLYD
QAYVGELPFTYPPFAGVVFTALSYLSDNWLIILWQGGTALALFLVFLLVFRERGYGFRPS
NWLISALLTLAAVATEPVHGTLFFGQINVFLMLLVALDFLPKWRLPGIGIGLAAGLKLTP
AFLGLVLLFQRRWWAAGISIVTFLATVGVGYWLIPDAHDFWMRAIFDSSRVGDHENPGAQ
SIRSVLEREFSIEGGIWWIAAVLVVFVLTCIAVYVAARRHNATVAMALTGISSCLVSPFS
WYHHWVWILPLFLAILLSVNNWIGQRLHGWFGAQVAGLASLLVMFIAASPFVTHIVWNAM
SYRYLDDVNGFGATVFIGTGVLFIAGYALSGLLPSRASSSTSGK

Enzyme Prediction     

No EC number prediction in MGYG000001533_02297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	69	298	2.8e-65	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	1.43e-48	41	345	46	359	mannosyltransferase; Provisional
pfam09594	GT87	6.58e-28	69	298	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS74468.1	5.90e-300	1	404	1	404
APT83467.1	5.90e-300	1	404	1	404
AHI21090.1	1.58e-223	1	395	1	395
AMJ45441.1	2.68e-220	1	398	1	398
AQX71896.1	2.68e-220	1	398	1	398

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R2K8	1.11e-39	40	330	57	354	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	8.43e-39	10	330	48	367	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1
P9WN01	8.43e-39	10	330	48	367	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pimE PE=1 SV=1
P9WMZ8	4.18e-27	5	315	4	341	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	4.18e-27	5	315	4	341	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000011	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24
88	110
122	144
164	186
193	215
255	277
284	301
305	323
335	357
372	394