CAZyme Information: MGYG000001533_02401

Basic Information

• Species: Corynebacterium ammoniagenes
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium ammoniagenes
• CAZyme ID: MGYG000001533_02401
• CAZy Family: GT2
• CAZyme Description: Galactofuranosyltransferase GlfT2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
648	MGYG000001533_1|CGC18	72993.07	5.002

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001533	2790185	Isolate	not provided	not provided

• Gene Location: Start: 2579551; End: 2581497 Strand: -

Full Sequence      

MTANNTVSDNAVQRILLPKRGEPFDVRMLYIIEAEQNRERLRWSNRASLTVPAGEEVSFQ
TYFNAFPASYWRRWSQLDSIILALDIDGEANISIYRSKQDGQRISVANHLVKTGHHEFEL
PLKNFEDGGWLWFDVTAETEATISQAAWCAPSAPGPQTMPDGTTIEPSDKRVAVGIPTFN
RPTDAVAALQALAEDPVVDGIIDFVLMPDQGNQHPADEPGYDEAVAHFGERFREFRQGNL
GGSGGYSRIMFEALENTESPFILYMDDDIAIEPDSILRAVQAARYAASPIIVGGQMLNLQ
ERSQLRTTGEQVDRGDFMWGAAPHAVYDHDFAKYPLSAIGDAQSHKDPSSYDSRALHRRV
DVEYNGWWMCLFPRVVAETNGQPLPLFIKWDDTEYSLRAAANGFPTVTWPGAAIWHMAWA
DKDDAIDWQAYFHLRNRLIVAALYHDGDTKGITRSIFKSTLKHTMCMEYSTMAIQIEAMR
DFLAGPDQLFDILETSLPRIAKLRSNYSDAVIIESADQLPAPTGAPGVPTHNIGGRLAKI
KKLPWAVKGLKHLLSKEDPRHHEAPQLNLTPDEARWFTLSRVDSATVSTAGGTGVAFRKR
DRDLARDLVEQTRELLNEIEENFDEMRRVYREALPELTSRESWRKIFE

Enzyme Prediction     

No EC number prediction in MGYG000001533_02401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	171	440	1.7e-41	0.9826086956521739

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17994	Glft2_N	2.34e-90	13	151	2	140	Galactofuranosyltransferase 2 N-terminal. This is the N-terminal beta-barrel domain found in the polymerizing galactofuranosyltransferase GlfT2 (Rv3808c). This enzyme synthesizes the bulk of the galactan portion of the mycolyl-arabinogalactan complex, which is the largest component of the mycobacterial cell wall such as in Mycobacterium tuberculosis. The N-terminal domain contains two short helices preceding a 10-stranded beta-sandwich with jelly roll topology.
COG1216	GT2	1.73e-58	168	504	1	305	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	1.23e-18	171	437	3	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04185	GT_2_like_b	1.23e-07	239	440	61	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
cd00761	Glyco_tranf_GTA_type	0.006	174	295	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APT83563.1	0.0	1	648	1	648
AQS74558.1	0.0	1	648	1	648
AMJ45538.1	0.0	1	648	1	648
AQX71994.1	0.0	1	648	1	648
ASJ19672.1	0.0	1	648	1	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4FIX_A	7.72e-226	12	643	29	642	CrystalStructure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIX_B Crystal Structure of GlfT2 [Mycobacterium tuberculosis H37Rv],4FIY_A Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv],4FIY_B Crystal Structure of GlfT2 Complexed with UDP [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R628	2.92e-230	1	646	9	635	Galactofuranosyltransferase GlfT2 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT2 PE=3 SV=1
O53585	2.12e-225	12	643	9	622	Galactofuranosyltransferase GlfT2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001533_02401.