CAZyme Information: MGYG000001534_00239

Basic Information

• Species: Xanthomonas_B massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xanthomonas_B; Xanthomonas_B massiliensis
• CAZyme ID: MGYG000001534_00239
• CAZy Family: CBM50
• CAZyme Description: 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668		71437.69	5.2631

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001534	3689702	Isolate	not provided	not provided

• Gene Location: Start: 266916; End: 268922 Strand: -

Full Sequence      

MPSIASPSRALPLLLCALLAACGSLPVADTGPAAAPADGARARIAILETTDVHSNILSYD
YYKLREDDSLGYERLATLIRQARQEFPDSFLFDDGDTIQGSVLADYQAKVKPVACDETLA
IYKAMNALGYDGGTAGNHEFNYGLGFLSQVTGTPMNVEGSVSEKCAGPDFPLVLSNVFSA
RDGQPIFKPWTIVSKPVTVTDADGHRRQVPLRVAIIGFTPPPIMEWDKQNLEGKVTVSGV
VEAAQRYLPQIQAQHPDLVVGILHGGLNPAPYTPDMENAGWHLAGVLGIDVVLLGHSHTE
FPGPRFAGMPEVDDERGFVRGKPAVMGGFFGKDLGVIDLALVRRDGRWTIDKDDTRSQVR
PICKGKDDCVPPDPAIAPLVAQAHRAALDYVNTPIGTSTVHFSSYFADEGNSTALAVVNA
AQRAYVQSELPRMHPELASVPVLSAAAPFRTGFGGPDDYTDVPAGPLTLRSAADLYFYPN
TLAAVETDGAGVKAWLEKSAERYNTLDPHRSGEQALINEKYVGYNVDQIQGGLHYVIDLA
RPAGQRITALTFNGKPVDPKQPFIVATNNYRANGGGNFPGLDGKNVVLAAPDGTREILAD
WLRTKGTVNAGDLEPTSWRFAPLRVAGPVTFKCAAGKEAVAHEAGLANVRQLHDNGDGTA
TCAIDLAR

Enzyme Prediction     

No EC number prediction in MGYG000001534_00239.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01390	CycNucDiestase	0.0	46	668	5	626	2',3'-cyclic-nucleotide 2'-phosphodiesterase. 2',3'-cyclic-nucleotide 2'-phosphodiesterase is a bifunctional enzyme localized to the periplasm of Gram-negative bacteria. 2',3'-cyclic-nucleotide 2'-phosphodiesters are intermediates formed during the hydrolysis of RNA by the ribonuclease I, which is also found to the periplasm, and other enzymes of the RNAse T2 family. Bacteria are unable to transport 2',3'-cyclic-nucleotides into the cytoplasm. 2',3'-cyclic-nucleotide 2'-phosphodiesterase contains 2 active sites which catalyze the reactions that convert the 2',3'-cyclic-nucleotide into a 3'-nucleotide, which is then converted into nucleic acid and phosphate. Both final products can be transported into the cytoplasm. Thus, it has been suggested that 2',3'-cyclic-nucleotide 2'-phosphodiesterase has a 'scavenging' function. Experimental evidence indicates that 2',3'-cyclic-nucleotide 2'-phosphodiesterase enables Yersinia enterocolitica O:8 to grow on 2'3'-cAMP as a sole source of carbon and energy (). [Purines, pyrimidines, nucleosides, and nucleotides, Other]
PRK09420	cpdB	0.0	46	668	28	649	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK09419	PRK09419	9.73e-165	44	644	42	626	multifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase/5'-nucleotidase.
PRK09418	PRK09418	3.05e-162	46	623	42	610	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.
PRK11907	PRK11907	6.63e-162	46	622	118	681	bifunctional 2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF95373.1	1.72e-152	37	668	35	666
APO43595.1	7.61e-149	37	630	29	617
QZN77538.1	8.07e-149	37	630	31	619
QLG37215.1	2.17e-147	37	630	31	619
QOS76560.1	7.45e-147	37	630	31	619

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EQV_A	2.92e-78	37	392	3	339	1.45Angstrom Crystal Structure of Bifunctional 2',3'-cyclic Nucleotide 2'-phosphodiesterase/3'-Nucleotidase Periplasmic Precursor Protein from Yersinia pestis with Phosphate bound to the Active site [Yersinia pestis CO92]
3JYF_A	2.42e-75	38	392	3	338	ChainA, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578],3JYF_B Chain B, 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase bifunctional periplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3GVE_A	1.48e-65	41	391	9	339	Crystalstructure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3GVE_B Crystal structure of calcineurin-like phosphoesterase YfkN from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
3QFK_A	1.18e-31	42	602	18	509	ChainA, Uncharacterized protein [Staphylococcus aureus subsp. aureus NCTC 8325]
4Q7F_A	1.18e-31	42	602	18	509	ChainA, 5' nucleotidase family protein [Staphylococcus aureus subsp. aureus COL]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26265	9.21e-141	34	641	14	618	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=cpdB PE=3 SV=2
P08331	1.30e-140	34	623	14	598	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Escherichia coli (strain K12) OX=83333 GN=cpdB PE=1 SV=2
P53052	5.80e-137	37	632	22	612	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Yersinia enterocolitica OX=630 GN=cpdB PE=3 SV=1
P44764	9.15e-134	44	623	34	608	2',3'-cyclic-nucleotide 2'-phosphodiesterase/3'-nucleotidase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=cpdB PE=3 SV=1
O34313	1.71e-121	41	623	42	612	Trifunctional nucleotide phosphoesterase protein YfkN OS=Bacillus subtilis (strain 168) OX=224308 GN=yfkN PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000004	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001534_00239.