CAZyme Information: MGYG000001534_00896

Basic Information

• Species: Xanthomonas_B massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xanthomonas_B; Xanthomonas_B massiliensis
• CAZyme ID: MGYG000001534_00896
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
768	MGYG000001534_6|CGC5	86277.26	6.1782

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001534	3689702	Isolate	not provided	not provided

• Gene Location: Start: 262189; End: 264495 Strand: +

Full Sequence      

MGTMSRNMRMPMLALVMATGLVHALAQASPATDAARGVLERSFGPQAAAVGLEQVDPPDS
PAGPWYRVQARGGRLAVDGSDAIALAHGAYAYLQSIGAADVSWEGRRVALPARFADHDGT
RVATPFLHRAYLNTCTYGYTTPFWDWSRWEREIDWMALHGIDMPLAMEGQEAIWQRLWRE
FGLADADLADYFSGPAFTPWQRMGNIEGYRAPLPQPWIDEKQALQKKILARMRELGMKPV
LPAFAGYVPKAFAQAHPRARIYRMRAWEGFHETYWLDPGDPLFARIARRFIELYAQAYGE
GEFYLADAFNEMLPPVADDGSDVAAAQYGDSTANTEAARAKAVPAARRDARLAQYGDAIY
RSISQVNPKATWVMQGWLFGADREFWQPGAIAAFLSRVPDDRMLVLDIGNDRYPGTWKAS
QAFDGKQWIYGYVHNYGGSNPVYGDFQFYRRDLQALLADRGHGNLAGFGVFPEGLHSNSV
VYEYLYSLAWEGPQLPWPQWLEHYLRSRYGHVDAALLAAWDDLDAAVYRTRYWSPRWWNK
KAGAYLLFKRPTTAVTGFEDRPDDLPRLRKALDALLAQAGHYQDAPLFRQDLVEYARQYL
SLQVDALLVQGVQAYQRGDIVGGDHVVARVEALVRGLDTLAGGQQESLGTWMRQAADYAG
DDAALRRYYLANARAQVSVWGGEGNLADYASKAWQGMYAGFYLPRWQRFFAGLRRAEVAG
EAFDQQAFEAQVRDWEWAWVGREDIPAATVPDDPAGLIRRLLARLDAS

Enzyme Prediction     

No EC number prediction in MGYG000001534_00896.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	72	762	3e-237	0.9939668174962293

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	8.59e-168	129	490	1	331	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.55e-49	500	752	1	252	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZM70076.1	0.0	31	767	31	765
AVQ05877.1	0.0	31	767	31	765
AZR33703.1	0.0	31	767	31	765
AZR29782.1	0.0	31	767	31	765
QDS14842.1	0.0	31	767	32	766

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XWH_A	5.60e-113	34	756	8	698	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]
2VC9_A	1.07e-68	73	743	212	850	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	1.18e-68	73	743	220	858	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	9.22e-68	73	743	235	873	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54802	3.93e-112	34	756	31	721	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2
Q9FNA3	1.74e-105	72	740	92	771	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003195	0.995117	0.000631	0.000501	0.000276	0.000236

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001534_00896.