CAZyme Information: MGYG000001534_02214

Basic Information

• Species: Xanthomonas_B massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xanthomonas_B; Xanthomonas_B massiliensis
• CAZyme ID: MGYG000001534_02214
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
238	MGYG000001534_7|CGC1	26648.82	11.4883

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001534	3689702	Isolate	not provided	not provided

• Gene Location: Start: 147476; End: 148192 Strand: -

Full Sequence      

MGAPRQSRKSRLWRWLLAVPLGLAGITVLQVLVLRFIDPPVSAMMVERQLGAWLHGQGDF
SLQHRWCDLEAMAPSVGISLVAAEDQRFPFHHGFDLAAIEKARDHNARGGRVRGASTISQ
QVAKNLFLWSGRSWPRKALEAWYTVLIELFWPKRRILEMYANVAEFGDGVYGAQAAARHF
WHKDAARLTPAQSALLAAVLPSPRRYDAARPGPFVQRRAAWIQRQAAQLGGPAYLGPR

Enzyme Prediction     

No EC number prediction in MGYG000001534_02214.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	63	223	6.9e-50	0.9096045197740112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	2.27e-129	11	235	7	232	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	3.52e-90	14	232	6	224	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	3.61e-72	5	231	13	245	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.81e-62	63	222	12	172	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.69e-31	69	225	72	223	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALE69525.1	4.49e-122	5	235	12	243
QLC69147.1	4.49e-122	5	235	12	243
AKS19570.1	4.49e-122	5	235	12	243
QOF06542.1	1.28e-121	4	235	14	243
BBJ95516.1	1.28e-121	4	235	14	243

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OQO_A	1.80e-24	58	224	13	182	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3NB6_A	2.53e-24	58	224	13	182	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
7U4H_A	2.85e-20	79	207	55	182	ChainA, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX],7U4H_B Chain B, Penicillin-binding protein 1A (Pbp1a) [Chlamydia trachomatis D/UW-3/CX]
4OON_A	1.43e-18	79	230	54	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
5ZZK_A	2.76e-17	79	207	72	207	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0RQA5	2.57e-122	4	235	14	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain B100) OX=509169 GN=mtgA PE=3 SV=1
Q8P6V1	2.57e-122	4	235	14	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=mtgA PE=3 SV=1
Q4UXB0	2.57e-122	4	235	14	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=mtgA PE=3 SV=1
Q8PI51	3.47e-120	8	235	15	243	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=mtgA PE=3 SV=1
Q3BQP8	4.33e-119	8	237	15	246	Biosynthetic peptidoglycan transglycosylase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000005	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
12	34