CAZyme Information: MGYG000001534_02683

Basic Information

• Species: Xanthomonas_B massiliensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales; Xanthomonadaceae; Xanthomonas_B; Xanthomonas_B massiliensis
• CAZyme ID: MGYG000001534_02683
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		42019.89	9.1432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001534	3689702	Isolate	not provided	not provided

• Gene Location: Start: 672988; End: 674199 Strand: +

Full Sequence      

MRARASRGLAAVLGLVSCLCAGAACAAVTPSVAATGVATAALPVDPASVPEPGFRNGQEI
FAAFRDGLAEPGCDAEATSERWRRQFSHAPRRLADADADVLPLFGYVVGELRAAGLPTEF
ALIPFVESGYRPDARSKNGPAGLWQFIPTTARNHEVPMEAGYDGRLSAADSTQAAVRYLR
SLHGMFGGDWRLAVMAYNAGEFRLLQSLRRSGMNASNAKPQALAGLSPVTYQYVQKLHAL
ACVLEDADRSGELTASLDRPVPVLATHTLSGQRSLQEWAAVRDLEPDRIARLNPVLAGAA
QPKAGRQVLAPAGARVVAEASASTAGAMAGAASPMIAAAEQAGRAVADVAKIGTHTVREG
ESAWGIARRYGLTVQALLSGNGLRSGAVLKPGMVLRLKAAEAP

Enzyme Prediction     

No EC number prediction in MGYG000001534_02683.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	104	241	8.7e-23	0.8740740740740741

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16894	MltD-like	1.10e-45	111	242	1	129	Membrane-bound lytic murein transglycosylase D and similar proteins. Lytic transglycosylases (LT) catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc). Membrane-bound lytic murein transglycosylase D protein (MltD) family members may have one or more small LysM domains, which may contribute to peptidoglycan binding. Unlike the similar "goose-type" lysozymes, LTs also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK10783	mltD	6.68e-43	102	403	103	393	membrane-bound lytic murein transglycosylase D; Provisional
pfam01464	SLT	1.75e-25	110	212	5	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	1.95e-15	126	210	10	91	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00118	LysM	3.79e-12	354	397	2	45	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASE53043.1	3.13e-156	7	398	4	398
SQG66267.1	3.13e-156	7	398	4	398
QJC76041.1	1.26e-155	7	398	4	398
AVH89308.1	1.26e-155	7	398	4	398
CAQ44558.1	1.73e-155	7	398	3	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EYB_I	1.52e-07	123	204	33	115	ChainI, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7EYB_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_B Chain B, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_D Chain D, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_F Chain F, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_G Chain G, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],7K5C_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]
6YT5_G	1.53e-07	123	204	55	137	ChainG, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_H Chain H, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_I Chain I, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_J Chain J, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_K Chain K, Peptidoglycan transglycosylase gp16 [Escherichia phage T7],6YT5_L Chain L, Peptidoglycan transglycosylase gp16 [Escherichia phage T7]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AEZ7	2.37e-28	93	402	91	389	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli (strain K12) OX=83333 GN=mltD PE=1 SV=1
P0AEZ8	2.37e-28	93	402	91	389	Membrane-bound lytic murein transglycosylase D OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=mltD PE=3 SV=1
P32820	4.94e-20	102	208	24	130	Putative tributyltin chloride resistance protein OS=Alteromonas sp. (strain M-1) OX=29457 GN=tbtA PE=3 SV=1
P03726	8.34e-07	123	204	33	115	Peptidoglycan transglycosylase gp16 OS=Escherichia phage T7 OX=10760 GN=16 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001179	0.223814	0.774413	0.000325	0.000159	0.000105

TMHMM  Annotations     

start	end
12	34