CAZyme Information: MGYG000001535_01387

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_01387
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
700	MGYG000001535_12|CGC6	79532.6	5.4471

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 301647; End: 303749 Strand: -

Full Sequence      

MSRIELQENGLYLVIEVAQEKEVRLLHFGASPLDETRIKEGQKSGFRLMELQLTGEDRAE
YHGRTHRASYPGLRMVYAGHTNCRNELGRKLEVTLRDPKTGLEAVQHVQFYDGVQTVRAW
TELYNAGSAAVSVEYVSSFALTGLDKEGGQDRDDKMTLSIPHSGWQSELQWRTYRLPELG
LSHLTDRSSKRISCSNTGSWSAAEHIPMAVLENRETNSSLFWQIEHNGSWHWEIFDQVDQ
LTLLLSGPTEHDNHWWKSLLPGERFVGVPVAVGATKGGFEAAIGQLTAYRRRIRRPNADN
RELRIIFNDYMNCLWGSPTTEKLLPLIDAAADAGCEYFCIDAGWYAPGEWWDGVGEWMPS
SERFPEGIKYVLDYIRSKGMVPGLWLELEVMGINSPKLADTDDSWFFLRHGKRVMDRSRY
QLDYRNPKVTAHADEVIRRLVEDYGVGYIKMDYNINAGIGTEASADSFGDGLLQHNRAYL
AWLDRIFARYPELVIENCSSGGMRMDYAMLSRHSIQSTSDQENYVNYAAIAAASPSAVTP
EQSAVWSYPLREGDDEEVVFNMVNALLLRVHQSGHLAELSPRRRELVKEALDYYKSIRAD
IPEALPFWPLGLPKQQDEWVSLGLRRPGSDTMYLAVWRTRGDITSQALPLLALQGEEPDI
RCAYPRDLDCAWSWNAADGQLTVTLPPAPSARLFEIRRQR

Enzyme Prediction     

No EC number prediction in MGYG000001535_01387.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	5	659	4.5e-97	0.9607558139534884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	2.43e-89	305	595	4	298	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	3.24e-30	289	510	27	250	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	4.35e-18	319	520	307	505	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14792	GH27	1.80e-10	331	470	33	140	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam16499	Melibiase_2	7.29e-06	332	387	45	98	Alpha galactosidase A.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMV41922.1	0.0	3	695	4	694
QJD85481.1	0.0	8	697	9	698
CQR54700.1	0.0	3	696	5	696
QQZ59050.1	0.0	3	696	5	696
AIQ17108.1	0.0	4	696	6	696

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XN0_A	7.05e-21	91	506	137	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN0_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM, PtCl4 derivative [Lactobacillus acidophilus NCFM],2XN1_A Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_B Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_C Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM],2XN1_D Structure of alpha-galactosidase from Lactobacillus acidophilus NCFM with TRIS [Lactobacillus acidophilus NCFM]
2XN2_A	9.31e-21	91	506	137	538	Structureof alpha-galactosidase from Lactobacillus acidophilus NCFM with galactose [Lactobacillus acidophilus NCFM]
4FNQ_A	1.83e-18	259	659	284	687	Crystalstructure of GH36 alpha-galactosidase AgaB from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
3MI6_A	6.88e-17	237	506	263	535	ChainA, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_B Chain B, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_C Chain C, Alpha-galactosidase [Levilactobacillus brevis ATCC 367],3MI6_D Chain D, Alpha-galactosidase [Levilactobacillus brevis ATCC 367]
2YFN_A	1.06e-15	201	659	224	679	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G1UB44	3.86e-20	91	506	137	538	Alpha-galactosidase Mel36A OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) OX=272621 GN=melA PE=1 SV=1
P43467	6.75e-20	91	509	135	539	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
P27756	5.23e-17	195	510	213	531	Alpha-galactosidase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=aga PE=3 SV=3
P16551	1.09e-15	321	512	309	497	Alpha-galactosidase OS=Escherichia coli OX=562 GN=rafA PE=1 SV=1
G4T4R7	6.98e-15	201	659	224	679	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_01387.