CAZyme Information: MGYG000001535_02369

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_02369
• CAZy Family: GH88
• CAZyme Description: Unsaturated glucuronyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001535_18|CGC12	42947.08	5.7979

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 363287; End: 364408 Strand: +

Full Sequence      

MWRYAIEDAVEKIRVNLDRYGTRFPHVSKKGTYLLNDNDDWTNGFWSGLLWLCYEYTGDE
VFRRGAVRTVEDFHRRLAENKVLDHHDIGFLYSLSSKAQWMVEKDERARQLTLEAADMLL
KRWRPAGGYIQAWGPEGDAKEGGRIIIDCLMNLPLLFWAGEQTGRSVYAEVARMQADKSR
RYLVRGDDSSYHTFFFDPQTGEPIGGATHQGYTNGSTWTRGQAWGVYGFALAYRYTKNPV
YLDTSKRMARYFLEHLPEDHVAYWDFDVPLESGTFRDSSASAIVAAGLQELIGLLGEHDP
DREDFQQGLIRSITSLVRNYATIGEQAEGLLKHGSYHVRGGQSPDDFMIWGDYFYLEALI
RLESGKVGYWYER

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	36	362	9.2e-124	0.9878419452887538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.61e-35	18	363	3	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4993	Gcd	0.007	185	271	383	457	Glucose dehydrogenase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX64906.1	1.61e-238	1	373	1	373
QOT12698.1	2.29e-238	1	373	1	373
AYB44800.1	1.54e-236	1	373	1	373
SMF90848.1	1.47e-234	1	373	1	373
AWV32503.1	4.03e-232	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VD5_A	4.30e-178	1	373	1	375	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	2.48e-177	1	373	1	375	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	7.50e-107	5	370	31	397	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	7.74e-107	5	370	32	398	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3ANI_A	4.40e-106	5	370	32	398	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RC92	2.36e-177	1	373	1	375	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q9A0T3	1.19e-108	5	370	33	399	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q8E372	4.24e-106	5	370	32	398	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	1.46e-103	5	370	30	396	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
T2KLZ3	3.25e-49	5	364	40	396	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_02369.