CAZyme Information: MGYG000001535_02376

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_02376
• CAZy Family: GH35
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610	MGYG000001535_18|CGC12	68952.99	4.629

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 372674; End: 374506 Strand: +

Full Sequence      

MSLLTWKNGQYWLDGRPYRIVSGAIHYFRVVPEYWKDRLLKLKASGFNTVETYIAWNVHE
PKEGEFHFTGMADVVSYIELAGELGLHVIVRPSPFICAEWEFGGLPGWLLRYGDIQLRCS
DPFYLSKVDRYYNELIPRLVPLLSTHGGPILAVQVENEYGSYGNDREYLDYLRNGLLRRG
IDVLLFTSDGPTDEMLLGGTLPDVHATVNFGSRVQESFRKYREYRTEEPLMVMEYWNGWF
DHWMEDHHVRDASDVAEVLDEMLEQGSSINMYMFHGGTNFGFYNGANHIAAYEPTITSYD
YDAPLTEWGDPTEKLAAVRAVLGKHGIEPACPFPEPVPKIAYGKVALTDRAELLAEGNLE
QLSEPVNSVSIQPMEKFGQSYGFILYSTFLDGPRTGQQLFLQEVRDRAQVFLDGRPIGVI
ERWNPQSLDISVPAGGAKLDILVENMGRINYGPLLRDAKGITEGVRIDNQFQYGWTVRTL
PLDPDALVALEYKDSDGQAEGAAGEPGMPGFYRGCFEAKEIGDTFLRLDGWNKGVAWING
FNLGRYWKAGPQRALYIPGPLLRKGKNELVLFELHGCPENREISLTDRPDLGRIAAVDDA
VLNFVQDEEL

Enzyme Prediction     

EC	3.2.1.23	3.2.1.38	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	12	322	3.4e-121	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	5.96e-151	10	323	1	316	Glycosyl hydrolases family 35.
COG1874	GanA	4.03e-61	7	600	4	615	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
PLN03059	PLN03059	1.81e-54	13	596	39	733	beta-galactosidase; Provisional
pfam02449	Glyco_hydro_42	7.00e-10	33	160	10	139	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SMF90826.1	0.0	1	610	1	610
AIQ34540.1	0.0	1	610	1	610
ACX64915.1	0.0	1	609	1	617
QOT12690.1	0.0	1	609	1	617
AIQ22730.1	0.0	1	610	1	610

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MAD_A	1.55e-226	1	594	15	596	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
4E8C_A	3.83e-166	11	594	10	590	Crystalstructure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]
7KDV_A	7.84e-158	4	589	18	627	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
3THC_A	1.88e-153	1	598	8	628	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	3.90e-153	1	598	32	652	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48982	1.25e-156	7	557	33	573	Beta-galactosidase OS=Xanthomonas manihotis OX=43353 GN=bga PE=1 SV=1
P23780	4.11e-156	4	589	35	644	Beta-galactosidase OS=Mus musculus OX=10090 GN=Glb1 PE=1 SV=1
Q60HF6	7.62e-154	4	592	34	645	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q8VC60	1.01e-153	7	591	31	619	Beta-galactosidase-1-like protein OS=Mus musculus OX=10090 GN=Glb1l PE=1 SV=1
Q58D55	1.25e-153	4	589	33	641	Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000042	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_02376.