CAZyme Information: MGYG000001535_03051

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_03051
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000001535_21|CGC4	42822.8	5.0656

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 115923; End: 117044 Strand: +

Full Sequence      

MNSAHTEIEKGRKEALTPLQWAEKACEALMAKYEPEQLPPDWFHYHQGVFLSGMEQCWRE
TGKQEYFDYIKRWVDSQVLEDGSIKKCHTGELDDIQPGVLLFNLYEQTGDERYKKALDKL
VPLLKSWPTNASGGFWHKNHFPNQMWLDGLYMAGPIAVQYAKTFGASEYFDMMTYQAILM
AERTRDPKTGLLYHGWDETKEAEWADPVTGLAPEFWGRAMGWYPIALLDMFEFLPEDHKD
KAKMIDILQDLLISLSRYQDATTGLWYQVVDKGDRADNWVEVSCSSMYVLSIAKAVRLGY
LDAKYLEVARKGYQGVIDTLKYDENGRMILGHICVGTNIGDYAHYVARPTSENDLHGAGA
FILMCMELNRAKL

Enzyme Prediction     

No EC number prediction in MGYG000001535_03051.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	43	369	1.1e-112	0.9578313253012049

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	2.18e-121	12	371	2	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.56e-115	21	372	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFC29184.1	1.24e-227	16	372	8	364
AFH61356.1	2.92e-226	16	372	8	364
AEI40556.1	4.15e-226	16	372	8	364
AZK46659.1	1.76e-224	17	371	9	363
ANY68695.1	7.70e-224	13	372	5	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	3.03e-121	17	368	12	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.24e-120	17	368	2	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.11e-86	41	367	21	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3PMM_A	3.78e-25	41	370	67	379	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.80e-24	41	317	66	329	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.66e-120	17	368	12	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.82e-24	152	367	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.82e-24	152	367	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_03051.