CAZyme Information: MGYG000001535_03261

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_03261
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
916	MGYG000001535_22|CGC5	103955.92	4.7161

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 204316; End: 207066 Strand: -

Full Sequence      

MELNNLRIEYMDNPLGLDVPNPRFSWHLVSSAQGVMQTAYQITVTKDTQEVWKSGKVEAD
TSILVEYAGLPLQASTLYQIHVTVWDNQDNQASIEGHFETGLLKGSNFTADWITHTFPDD
EPAPPVFQKIFTVEKDIQSARLYASSLGVYEISINGNRVGDRYFAPGWTNYNERLQYQTY
NLDGLLERHNKIEITVGNGWYKGIFGFTCTPNHYGDRVAAIAELHIVYTDGSKEMIRTDD
SWKVTQGPIRSSEIYMGETYDSCYVDDTLYDVVPFSYNNERLVAQESEPVSITRRLPAVK
FFTTPKGEQVIDFGQILTGFVELQITGREGQVITIRHAEVLDKEGNLYPETLRQAVSIDR
FICNGKEQVFRPHFTFHGFRYIAVEGLEIIQPELFTACVLHSHLEETGRLTTSNEMVNQL
FSNIQWSQRGNFLDIPTDCPQRDERLGWTGDAQVFAGTAAFNMNVASFFTKWLRDLASEQ
TEEYGVPQVIPNILGNQEGAAAWGDAAVIVPWTMYQMYGDLRLLEQQYDSMKGWVDYITG
RCGANGLWQTGFQYGDWLALDKEEISNERTGATDVYLVANAYYAYSTELLAKTARVLNKS
EDASQYETLHRQIKSAFQEEYISATGRLVSETQTACVLALHFNLVDDKHRERVRKTLESN
IAQHKNHLTTGFVGTPYLCHVLSENQMHELAGILFLKEDFPSWLYAVKKGATTIWERWNS
ILPNGDFDTSGMNSLNHYAYGSIGEWMYRKLAGINQIEPGFKKILIHPQFIKGISAVEGT
YHSVYGEIKSSWSCRNGEIIVNVTIPANTTAVIKLPEQEDPIEVGSGDYCFRYPTQTNLD
IERFTLDSTLKEVIEEPIAVQIIEEHAPGMLDHPMIQYAYNFSISELLTNTPEETAMLFK
LVLKTLNEPKEQGAMR

Enzyme Prediction     

EC	3.2.1.40

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	303	815	4e-183	0.9940476190476191
CBM67	110	263	2.7e-25	0.8238636363636364

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.18e-154	405	749	1	338	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.66e-59	135	294	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.41e-31	303	401	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.73e-22	753	827	1	75	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLG40468.1	0.0	1	907	1	907
QRT30265.1	0.0	1	911	1	909
QRT50983.1	0.0	1	907	1	910
VCV22853.1	0.0	1	907	1	910
CBL11431.1	0.0	1	907	1	910

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.37e-182	8	816	11	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.74e-174	1	827	2	859	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	5.13e-154	5	828	34	911	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	5.27e-182	8	816	11	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	3.43e-181	9	869	42	916	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.12e-161	13	811	42	874	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	8.30e-112	1	819	30	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_03261.