CAZyme Information: MGYG000001535_03264

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_03264
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
852	MGYG000001535_22|CGC5	95436.8	5.9943

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 211766; End: 214324 Strand: -

Full Sequence      

MLKIKSIKIDGAETECITDKRPVISFVLESDQAGEALKEATIEVGNWKVVTTDQINNLYQ
GPLAPHTEYKIQINATGVSGETASGSASFQTGRLDIPWKAQWITDLSYDFPKKVSPVPMT
FRHSFALTQEIKKAWIHATALGVYEMQLNGEKVGKDYFAPGFTSYDHQIQYQTYDIGSLL
QNSNTITAVLAGGWAVGSFNYVRKNKISADRQAFLCEIHIEYADGSSDIIASDTSWEVSL
EGNYKMAEWYDGETYDATIDLHHIRWKRADITAPRKKPALLAQYGPPVRVQEILRPISQV
HSPSGEVIYDFGQNFAGVISAKIRGKRNQEIVFRHAEVLVDGELFVKSLRTAKATATYIC
VEGEQVYSPKLTYMGFRYVGLRGIAPEDIELSAYVLHSDFREIGSFSCSNDLINQLQSNI
RWGGRSNFVDIPTDCPQRDERQGWTGDIAVFASTACFNFDMGRFFDKWLLDMRSEQSKGG
GFPMVIPRAGDHWPALANSCWGDSSILVPWAEYLARGNRQVLQQQYPAMKKFLKAAKWWS
SFLAVSPTDRYIWRFPFHFGDWAAPDENVKEWLKKGKWVGTAYFANSCRIVSQIAEILGY
PEDASYYLELREKIVAAYRNAFTDSEGTLKKEFQTGYVLPLHFGMTEGKETEVMVQNLVR
LIKEAGNHLTTGFTGTPYLLFALSDHGHLDAAYDLLLQEECPSWLYEVKAGGTTIWERWD
SLRPDGTVNIDDLSGKKSGEESSGGMVSFNHYANGAVGDWLYKRMVGIEPTSGGYRTFQI
APMPGGGVTWAEAATETPYGTVSAAWRIEDEKFTITAKVPVSAQCLLKMPNGETHSLLSG
EHTFHCNYHTAV

Enzyme Prediction     

EC	3.2.1.40	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	301	825	1.9e-158	0.9861111111111112
CBM67	100	268	2.4e-27	0.8693181818181818

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.71e-122	401	765	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	2.12e-49	130	292	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.61e-23	301	397	2	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.78e-17	767	844	1	77	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKJ20504.1	0.0	2	846	1	844
QNO38777.1	0.0	1	846	1	844
QFU98406.1	0.0	2	846	1	845
QEI31654.1	0.0	1	843	1	843
QHB24153.1	0.0	1	843	1	843

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	5.83e-147	113	830	294	995	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	3.21e-142	62	845	71	864	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
6I60_A	1.82e-117	17	830	46	899	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	2.34e-146	113	830	294	995	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.79e-142	88	837	138	886	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	3.01e-125	84	820	131	869	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KPL4	1.90e-76	17	844	46	921	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_03264.