CAZyme Information: MGYG000001535_03758

Basic Information

• Species: Paenibacillus_A phocaensis
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A phocaensis
• CAZyme ID: MGYG000001535_03758
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
346	MGYG000001535_29|CGC1	39121.63	5.0407

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001535	5515101	Isolate	not provided	not provided

• Gene Location: Start: 46950; End: 47990 Strand: -

Full Sequence      

MLRLNLAPSELKPIIERVVEYTFEMDLTWDWPCGVAYYGISRVFEATGESAYVERMIQWC
EEYIEAGLPVWTVNTCAMGHMLITLYEQTKEQKYLDLILSKIDYLQNQAPRFGDRVLQHT
VSAGNDFPEQCWADTLFMAAYFMLRTGVLLGEKPWIDDALHQFYWHINYLQSEDTGLWYH
GYNHLSQDHMSGIYWARANAWAAYTMARAAKGLPEAYLYPPMMHIWSSLRDQLAALKKLQ
HEDGLWGTVLDYPGAYGEVSATAGIAAAMITQGNPLHAKYVQKALDGVLANLSGNGRVLN
VSGGTAVMKDIEGYLQVDRKWAQGWGQGLTLALLAAVIENEQLSRS

Enzyme Prediction     

No EC number prediction in MGYG000001535_03758.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	27	337	2.3e-76	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	8.91e-92	1	344	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	3.52e-78	16	331	14	333	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKS48636.1	1.30e-206	2	339	1	338
ACX67065.1	2.78e-205	2	339	3	341
QNK60304.1	3.95e-205	2	340	1	339
ANY76770.1	1.00e-202	2	339	3	341
AIQ51125.1	3.49e-200	2	339	1	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QWT_A	1.15e-39	6	340	21	379	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	1.20e-38	29	317	66	358	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
4XUV_A	3.80e-38	29	334	47	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
4WU0_A	3.48e-19	12	270	6	275	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.59e-15	29	251	39	266	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.51e-104	1	342	1	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.42e-14	29	251	39	266	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001535_03758.