CAZyme Information: MGYG000001536_01383

Basic Information

• Species: Enterobacter_A timonensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_A; Enterobacter_A timonensis
• CAZyme ID: MGYG000001536_01383
• CAZy Family: GH77
• CAZyme Description: 4-alpha-glucanotransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
695	MGYG000001536_11|CGC2	78334.56	7.3683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001536	4199690	Isolate	not provided	not provided

• Gene Location: Start: 113746; End: 115833 Strand: +

Full Sequence      

MDSKRLDNAALAAGISPSYINAHGKPQSIGAETKRRLLDAMHKVKPVAKAAVSPVPNVKV
FTAGKKMALEVEGSGEFNWLLTTEEGSLHKGHATGGKKLNLPAKLPEGYHTLTLTRDNRR
WHCRLIVAPKRCYEPQALLDGKKLWGACVQLYTLRSEVNWGIGDFGDLKKMLSEVGERGG
AFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFRNSPEAQAWWKLDTTQH
ALKKAREAEWVDYSAVTALKMAALRLAWKGFSARDDEQMTAFRQFVMQEGESLYWQAAFD
AIHAYQVTEDEMRWGWPVWPEAYRSVDTPEVKAFCDEHADEVNFYLWLQWLAYSQFAACW
EVSQGYQMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHVMVARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADQGAYVQYPVDDLL
AILALESKRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFENDHEKTFRAPKAYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKHGC
LPKRVGHKAARMAMTPTLNRGLQRYIADSNSALLGLQPEDWLDMADPVNIPGTSYQYKNW
RRKLSTSLEEMFADDGVNRLIKDLDKRRKAVGKKR

Enzyme Prediction     

EC	2.4.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH77	149	686	3.8e-162	0.9898785425101214

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00217	malQ	0.0	130	686	1	513	4-alpha-glucanotransferase. This enzyme is known as amylomaltase and disproportionating enzyme. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1640	MalQ	0.0	132	690	1	518	4-alpha-glucanotransferase [Carbohydrate transport and metabolism].
PRK11052	malQ	0.0	1	694	1	695	4-alpha-glucanotransferase; Provisional
PRK14507	PRK14507	0.0	1	688	3	721	malto-oligosyltrehalose synthase.
pfam02446	Glyco_hydro_77	0.0	149	665	1	458	4-alpha-glucanotransferase. These enzymes EC:2.4.1.25 transfer a segment of a (1,4)-alpha-D-glucan to a new 4-position in an acceptor, which may be glucose or (1,4)-alpha-D-glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOP84353.1	0.0	1	695	1	693
AVF17152.1	0.0	1	695	1	693
QLA68836.1	0.0	1	695	1	693
QKZ97396.1	0.0	1	695	1	693
AMJ68881.1	0.0	1	695	1	693

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4S3P_A	0.0	1	687	1	686	AmylomaltaseMalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3P_B Amylomaltase MalQ from Escherichia coli, apo structure [Escherichia coli K-12],4S3Q_A Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_B Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12],4S3Q_C Amylomaltase MalQ from Escherichia coli in complex with maltose [Escherichia coli K-12]
4S3R_A	0.0	2	687	2	686	AmylomaltaseMalQ from Escherichia coli in complex with the pseudo-heptasaccharide acarviosine-glucose-acarbose [Escherichia coli K-12]
5B68_A	2.13e-76	78	660	116	673	Crystalstructure of apo amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum],5JJH_A Crystal structure of amylomaltase from Corynebacterium glutamicum [Corynebacterium glutamicum]
2X1I_A	1.74e-26	160	559	20	405	glycosidehydrolase family 77 4-alpha-glucanotransferase from thermus brockianus [Thermus brockianus]
2OWC_A	3.28e-22	251	559	98	407	Structureof a covalent intermediate in Thermus thermophilus amylomaltase [Thermus thermophilus],2OWW_A Covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose [Thermus thermophilus],2OWX_A THERMUS THERMOPHILUS AMYLOMALTASE AT pH 5.6 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P15977	0.0	1	695	1	694	4-alpha-glucanotransferase OS=Escherichia coli (strain K12) OX=83333 GN=malQ PE=1 SV=2
P45176	1.17e-166	69	677	74	686	4-alpha-glucanotransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=malQ PE=3 SV=1
P9WK22	3.18e-89	54	691	68	707	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=malQ PE=3 SV=1
P65337	3.18e-89	54	691	68	707	4-alpha-glucanotransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=malQ PE=3 SV=1
P9WK23	3.18e-89	54	691	68	707	4-alpha-glucanotransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=malQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001536_01383.