CAZyme Information: MGYG000001536_02384

Basic Information

• Species: Enterobacter_A timonensis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter_A; Enterobacter_A timonensis
• CAZyme ID: MGYG000001536_02384
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
150	MGYG000001536_11|CGC17	17156.7	9.2557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001536	4199690	Isolate	not provided	not provided

• Gene Location: Start: 1189023; End: 1189475 Strand: +

Full Sequence      

MKRWLFLLVLLSQSALANCWDRAAHYYHVDPWLLYAIAHVESGMNPYAVGQNSDGTRDVG
LMQINSSHFPALKRQGIDEYRLTMEPCTSVMVGASILSDMIKVYGNNWEAVGAYNAGLKP
ENFPRRMVYARKVWRQYQQIKQHAHEKAPG

Enzyme Prediction     

No EC number prediction in MGYG000001536_02384.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	29	144	3.5e-23	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	4.10e-87	1	147	1	149	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	7.41e-56	27	139	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	1.75e-30	20	134	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	9.64e-27	1	150	1	155	lytic transglycosylase; Provisional
cd00254	LT-like	3.39e-15	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOP86134.1	6.72e-83	1	146	1	146
QMR77356.1	7.69e-83	1	147	1	147
AFM59212.1	1.09e-82	1	141	1	141
QUC28639.1	1.36e-82	1	141	1	141
QIB81505.1	1.93e-82	1	146	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.26e-09	18	102	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.32e-44	9	141	11	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.32e-44	9	141	11	143	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	1.32e-44	9	142	11	144	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q55287	4.15e-34	1	140	1	141	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1
Q07568	1.67e-33	1	140	1	141	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000252	0.999077	0.000184	0.000150	0.000149	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001536_02384.