CAZyme Information: MGYG000001537_00955

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_00955
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
340		37005.74	7.0325

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 233785; End: 234807 Strand: +

Full Sequence      

MTTLPRVTALMLAYGAEPYLLDAVEAVLASTGVDVDLVLVDNGCTTDAVRRLPEDPRITL
VVPAENLGFTGGMNLAASRASGDVLLLVNSDAIVEPAAASELVGALATPGVGVVGGSVRL
ADEPDLVNSVGNPLHVLGLSWAGGMGDPAAQHTTRGPVASASGACMALSRSLWESLGGLV
EPFFAYAEDLELCWRSWQRGLRVEYVPTAVAYHHYEFSRTPLKMYLVERNRLAFVLTCYG
GRMLLLLAPVLAAFELALVAVAAKQGWLRQKLRGWWWLATHARWIRARRAEVQRERRVPD
RELADLMTDRFDPAQFPLPAGSHLLQSALARYWRAVRRAL

Enzyme Prediction     

No EC number prediction in MGYG000001537_00955.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	233	2.3e-26	0.9869565217391304

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	9.66e-39	14	215	6	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	6.67e-36	5	294	3	303	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	2.81e-20	5	231	2	226	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
COG1215	BcsA	5.02e-16	4	233	53	281	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam00535	Glycos_transf_2	6.18e-16	8	172	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACZ20850.1	3.34e-140	7	338	19	350
QHT56323.1	3.59e-140	2	340	4	344
ADG75242.1	1.95e-128	6	340	3	337
QAY68898.1	3.58e-122	4	338	1	336
QKW14308.1	5.85e-119	5	340	4	339

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	1.05e-09	5	219	574	798	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
D4GU63	1.44e-07	36	231	45	245	Low-salt glycan biosynthesis hexosyltransferase Agl10 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=agl10 PE=3 SV=1
P04341	2.04e-06	4	210	48	262	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
P33697	3.05e-06	5	96	10	103	Succinoglycan biosynthesis protein ExoO OS=Rhizobium meliloti (strain 1021) OX=266834 GN=exoO PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
241	263