CAZyme Information: MGYG000001537_01483

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_01483
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293	MGYG000001537_11|CGC10	31402.47	10.7199

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 386675; End: 387556 Strand: -

Full Sequence      

MSPARRLTRRIAAAATTALAAALLVALPSSPALAHGGLTYPATRTYACYVNGIENGVGGG
LNPTNPACVNMLAENGNYPFYNWFGNLLSNAGGQHRTIIPDGNLCGPLASFSGARKGGTD
WPTTTLQSGSTITMQYNAWARHPGTWSQYVTKDGWNPSQPLKWSDLEAAPFDEVTNPPLR
EGGPQGAEYYWQAKLPNKSGRHIIYSIWQRSDSPEAFYNCSPPHLPGRRPPPPRHVPSVP
RGQSPRPLDRLPAGGAVRPPHLARGAARPCGARRKGVAGSVSRRAGGCRRAVR

Enzyme Prediction     

EC	1.-.-.-	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	35	221	2.4e-42	0.9775280898876404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03067	LPMO_10	7.58e-70	35	221	1	184	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21177	LPMO_AA10	4.62e-60	35	221	1	177	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	5.40e-35	28	221	23	203	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
cd21178	Fusolin-like	5.35e-15	35	221	1	223	fusolin and similar proteins. Fusolin is a protein found in spindles of insect poxviruses that resembles the lytic polysaccharide monooxygenases of chitinovorous bacteria and may function to disrupt the chitin-rich peritrophic matrix that protects insects against oral infections. Thus, it is a component of the virus occlusion bodies (which are large proteinaceous polyhedra) that protect the virus from the outside environment for extended periods until they are ingested by insect larvae.
PHA03387	gp37	1.49e-13	34	221	19	246	spherodin-like protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASO19898.1	7.80e-108	15	221	12	219
APU20422.1	2.37e-107	15	221	12	219
APU14453.1	2.37e-107	15	221	12	219
AOS63069.1	2.00e-105	15	221	12	219
QOS58239.1	3.33e-105	15	221	12	218

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OY7_A	2.45e-47	35	221	1	189	Structureof cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_B Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_C Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_D Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_E Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_F Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_G Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)],4OY7_H Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper. [Streptomyces coelicolor A3(2)]
6IF7_A	3.26e-44	35	221	1	178	CrystalStructure of AA10 Lytic Polysaccharide Monooxygenase from Tectaria macrodonta [Tectaria macrodonta]
5FJQ_A	3.47e-26	35	220	1	174	Structuraland functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_B Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus],5FJQ_C Structural and functional analysis of a lytic polysaccharide monooxygenase important for efficient utilization of chitin in Cellvibrio japonicus [Cellvibrio japonicus]
4GBO_A	1.97e-23	29	221	31	217	Structureof T.fusca E7 [Thermobifida fusca],4GBO_B Structure of T.fusca E7 [Thermobifida fusca],5UIZ_A Structure of T.fusca AA10A [Thermobifida fusca],5UIZ_B Structure of T.fusca AA10A [Thermobifida fusca]
5OPF_A	1.53e-19	35	221	1	189	Structureof LPMO10B from from Micromonospora aurantiaca [Micromonospora aurantiaca ATCC 27029]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3KKC4	1.06e-45	34	221	34	223	Lytic cellulose monooxygenase OS=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) OX=278992 GN=SAM23877_1271 PE=1 SV=1
Q02I11	8.48e-42	15	220	6	204	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=cpbD PE=1 SV=1
Q9I589	8.48e-42	15	220	6	204	Chitin-binding protein CbpD OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cbpD PE=1 SV=1
A1JQE6	8.29e-09	22	219	9	186	GlcNAc-binding protein A OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=gbpA PE=3 SV=1
Q8GBD4	8.29e-09	22	219	9	186	GlcNAc-binding protein A OS=Yersinia enterocolitica OX=630 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000341	0.998925	0.000157	0.000236	0.000174	0.000150

TMHMM  Annotations     

start	end
12	34