CAZyme Information: MGYG000001537_01596

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_01596
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552	MGYG000001537_11|CGC13	61467.65	8.0469

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 510843; End: 512501 Strand: +

Full Sequence      

MAATTFDRLVTEPRTTDVPHGRPARTPENEAAHSPSFMLLVALACAGVLLYAVFLLNPGN
RGDWLPWSMVITAEAVLIVHALLSLWTMLSSGHNPRGFAFHHAQDALYDMDEILRDGTAD
NPRHWPMRLHGSPVGIDVFITTYGEDLATIRRTVTAALAMQGEHMTWVLDDGRSDEVRDL
AAELGARYVRRLSKNGAKAGNINHALTITRGELFVIFDADFVPEPEFLHETVPFFATSDV
AFVQTPQTYGNLHNLISRGAGYMQAVFYRYIQPGRNKFNSAFCVGTNVIFRRRAILDVGG
MYADSKSEDVWTSLRLHEAGWRSIYIPMSLAVGDTPETVEAYTKQQLRWATGGFEIMFTH
NPLSKKRNLTLDQRLQYWVTSTHYLTGIAPLLLLLVPPLQVYFGLTPMQLHMSPVTWALA
YAGFYVMQIVVAFYTLGSFRWETLMLATVSFPIYTRALVNAFFRREQQWHVTGSLGRASS
PFNFMMPQVLFFAFLLLTSVVGAWKDLGNGSLSLALAWNTTNTLILGAFVVTAAREARAS
RRAAALTSGGAA

Enzyme Prediction     

No EC number prediction in MGYG000001537_01596.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	214	419	1.5e-28	0.9543147208121827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06421	CESA_CelA_like	1.25e-95	136	357	3	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
PRK11498	bcsA	6.01e-52	121	388	255	522	cellulose synthase catalytic subunit; Provisional
COG1215	BcsA	4.79e-47	136	522	56	423	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06435	CESA_NdvC_like	1.39e-40	143	360	7	235	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
cd06437	CESA_CaSu_A2	6.52e-40	168	353	37	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT57175.1	1.43e-306	3	544	2	543
VEH36553.1	2.79e-303	3	544	2	543
AEE47568.1	2.79e-303	3	544	2	543
QVI64502.1	6.09e-300	3	548	2	547
ASR54656.1	1.78e-297	4	544	3	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	3.65e-42	125	397	256	544	ChainA, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	2.02e-39	98	544	93	570	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	2.77e-39	98	544	105	582	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	2.78e-39	98	544	106	583	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8X5L7	7.87e-42	125	397	256	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
P37653	1.93e-41	125	397	256	544	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
Q93IN2	6.42e-41	125	543	256	698	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
Q8Z291	1.17e-40	125	543	256	698	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
Q9WX75	4.45e-40	125	403	129	422	Putative cellulose synthase 3 OS=Komagataeibacter xylinus OX=28448 GN=bcsABII-B PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999993	0.000018	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
32	54
64	86
375	397
417	439
482	504
514	533