CAZyme Information: MGYG000001537_01916

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_01916
• CAZy Family: GT0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
454	MGYG000001537_12|CGC7	48316.14	8.9287

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 221331; End: 222695 Strand: -

Full Sequence      

MTISARHVARFARRHGVRELIRRGIRRLAARLDAQAPDLPLLAGDVADSTRVRLASPPVR
PRRARPLHIGWLCTPPSLGSGGHTTMFRMIEALEAAGHTCTVFLYDRHGGDVREQAAVVR
AGWPGVQARILSADGGIVGVDACVATSWPTAHVLASRGTMPMRRLYFVQDFEPYFFPRGS
RYALAEDSYRLGLRMIALGEMVAGTLAREVGVDVDVVPFGCDTDTYALDPASPAAAAAAD
GARTGVVLYAKPGVGRRGYLLARLALEQFHARHPEQEIHAYGERFTDVTFPVTWHGRLTP
VELAALYRRCSAGFALSFTNISLVAEEMLAAGLVPVVNDHPDARADLVSPHVVWAPPTPG
GLAAGLERALACPEPRSVLAASARQGWGPAQRGVVRIIEEAVYGAADVRPSRPGHDAPAV
RATPHPGAAASQEAAVSQEAVGPGPASSRPAATS

Enzyme Prediction     

No EC number prediction in MGYG000001537_01916.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	3.20e-13	68	385	1	346	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	7.76e-08	74	385	9	355	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	2.54e-06	292	385	61	157	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03819	GT4_WavL-like	0.003	173	386	112	335	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.
PHA03247	PHA03247	0.008	341	454	2733	2840	large tegument protein UL36; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFV89761.1	6.15e-155	4	404	17	410
APZ08382.1	6.15e-155	4	404	17	410
ALN15871.1	6.15e-155	4	404	17	410
AMS04364.1	1.24e-154	4	404	17	410
AOZ45858.1	1.24e-154	4	404	17	410

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q50864	2.52e-15	82	370	927	1220	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001537_01916.