CAZyme Information: MGYG000001537_02416

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_02416
• CAZy Family: CBM2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
548		56627.27	8.2596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 767494; End: 769140 Strand: +

Full Sequence      

MAFIRHSHHSPTGRRRPVLITTALAAVAALLAALAVTQPAFAAGSISATFTSAGDWGTGH
QVNVKVTNSGTTPVNGWTLEFDLPAGNALGSSWDADVTRAGNHYTAKNKGWAATLTPGAS
FTWGYVATGPFASPTACSINGVACAGGTPTTSPTPTPTPTTTPTPTPTPTPTTTPQPGGK
KLVGYFTEWGVYGRNYHAKNVATSGSASKLTHILYAFGNTTGGKCSIGDAYAAYDKAYTA
ADSVDGVADTWDQPLRGNFNQLKKLKAMNPGLKVIWSFGGWTWSSGFTQAAANPTAFADS
CYQLLNDPRWAGLFDGIDIDWEYPNACGLTCDSSGPAAFNNVITALRSKFGSSKLITAAI
TADGSSGGKIDAADYAGGAQKLDWIMPMSYDYFGAFNPTGPTAPHSPLTSYAGIPQAGFN
TEAAVDKLIGKGIPANKILLGVGFYGRGWTGVTQTAPGGSATGAAPGTYEAGIEDYKVLK
TKCPVTGTVGGTAYAKCGSEWWGYDTPSTLAGKTSWAKNKGLGGAFFWELSGDTANGELI
SALSNGLK

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	180	542	1.5e-70	0.9662162162162162
CBM2	47	144	4.3e-28	0.9801980198019802

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	5.25e-107	183	533	2	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.44e-99	181	533	1	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	8.47e-79	181	533	1	307	Glycosyl hydrolases family 18.
COG3325	ChiA	3.72e-63	181	547	39	436	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02872	GH18_chitolectin_chitotriosidase	3.68e-55	182	547	1	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVI65285.1	0.0	1	548	1	546
ASR54828.1	2.95e-299	14	547	19	555
AEI11791.1	3.50e-296	32	547	40	557
AAG27061.2	7.63e-294	39	544	50	567
AAF00931.2	1.89e-291	15	548	17	557

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4W5U_A	4.23e-192	179	547	40	407	Crystalstructure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus],4W5U_B Crystal structure of chitinase 40 from thermophilic bacteria Streptomyces thermoviolaceus. [Streptomyces thermoviolaceus]
1KFW_A	1.35e-78	179	545	8	419	Structureof catalytic domain of psychrophilic chitinase B from Arthrobacter TAD20 [Arthrobacter sp. TAD20]
1ITX_A	5.49e-57	181	533	13	406	ChainA, Glycosyl Hydrolase [Niallia circulans]
6EPB_A	4.73e-50	185	545	43	395	Structureof Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
6YLJ_A	4.66e-48	185	545	43	395	ChainA, Endochitinase 42 [Trichoderma harzianum],6YN4_A Chain A, Endochitinase 42 [Trichoderma harzianum],7AKQ_A Chain A, Endochitinase 42 [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11220	1.76e-216	23	548	9	610	Chitinase 63 OS=Streptomyces plicatus OX=1922 GN=chtA PE=1 SV=2
P36909	2.40e-216	23	538	9	599	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
P20533	5.40e-54	181	533	45	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	4.20e-49	185	545	44	402	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	5.00e-49	185	545	43	395	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001700	0.996912	0.000263	0.000649	0.000245	0.000218

TMHMM  Annotations     

start	end
20	42