CAZyme Information: MGYG000001537_02771

Basic Information

• Species: Cellulomonas timonensis
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Cellulomonadaceae; Cellulomonas; Cellulomonas timonensis
• CAZyme ID: MGYG000001537_02771
• CAZy Family: GH2
• CAZyme Description: Exo-beta-D-glucosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	MGYG000001537_13|CGC1	93156.24	4.6956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001537	4057828	Isolate	not provided	not provided

• Gene Location: Start: 27583; End: 30117 Strand: -

Full Sequence      

MYRLDLHDGWTLRATGGPVPAEIAGQTVAAEIPGSAHTDLLAAGLIPDPYLDQNETALAW
MHRADWRYSRDLALEPADADERVDLVFEGLDTVAEVRLDNALVGATANQHRSYRFDVRWA
ADGTARTLAVDLRSALEHAEALRDRIGARPTAYDHPFNMVRKMACSFGWDWGPDLQTAGI
WKPVRVERWRTARLAQVRPQVTVDADGTGQVAVHVEVERSGLAGSRDAALVLRARIGDVE
GEVALAPGQDSATVSVTVPHAPLWWPVGHGAQPLLDLDVTLEESAPAAASPVALDSWRRR
IGFRTVELDTQPDEFGSSFTLRVNGRPIFVKGANWIPDDHLLTRITRAQVARRVDQALGA
NLNLLRVWGGGVYESEDFYDVCDERGVLVWQDFLLACAAYPEEAPLWDELEAEARENVAR
LTPHASLVLWNGGNENLWGFEDWGWKDRLNGATWGRRYATELFPAIVAELDPTRPYMDGS
PYSPDSAPEGAHPNDPDHGTHHQWEVWNRVDYAAYRDEVPRFCSEFGFQGPPAWATLERA
VRNADGAPLSKTDPVFLLHQKADDGNGKLDRGLAPHLGVPADFGDWHWATQLNQARAVQH
AIDHYRAWWPRTTGAIVWQINDCWPVTSWAAVDGDERPKPLWYALRHAFADRVLSVHERD
GRLALAVVNDSPELWQGAVRMRRELFDGTLLAESTQPVSVGARSVALLPLPDDVRTPGDP
RREVLVAELDGIRSVHLWAEDVVLDLDPTPLKVTATPADGGYRVDATARSLARDVTLLVD
RLDPDATVDDALVTLPAGATVTFWVKTSARLDERALTSAPVLRTANDLVATRADDVALVA
APVD

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	3	724	6.9e-98	0.7087765957446809

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.98e-76	3	783	12	767	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	3.98e-06	192	304	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	3.41e-05	298	439	312	453	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	6.80e-05	323	475	10	157	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAD42775.1	0.0	1	832	1	826
VEH34489.1	0.0	1	832	1	826
AEE46894.1	0.0	1	832	1	826
QHT54986.1	0.0	1	833	1	828
QVI66780.1	0.0	1	832	1	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	6.87e-124	30	708	46	712	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
6BYE_A	1.00e-121	1	833	3	855	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	1.03e-121	1	833	3	855	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	7.19e-121	1	833	1	853	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	7.36e-121	1	833	3	855	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B7W2	1.28e-104	6	656	9	660	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2
Q2TXB7	7.05e-103	6	770	9	783	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
B8NW36	1.37e-102	6	645	9	649	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
A2QYN2	1.39e-101	32	645	32	649	Beta-mannosidase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mndB PE=3 SV=1
Q4WAH4	2.86e-98	1	645	4	649	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000004	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001537_02771.