CAZyme Information: MGYG000001538_01471

Basic Information

• Species: Collinsella ihuae
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella ihuae
• CAZyme ID: MGYG000001538_01471
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470		52990	8.6683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001538	2836446	Isolate	not provided	not provided

• Gene Location: Start: 104233; End: 105645 Strand: -

Full Sequence      

MSPAAAFVQGFLWAVGVFFVIYLIGYATFLFLSVTVGSTLLNQRKHEARYRSHIAKDCFV
PISIIVPAHNEGVTVASSVTSLLKLDYSLYEIIVVDDGSTDDTAEKVIEEFLLERMERPV
QLRIKTQPIKSIWVGEANGIPITLVSKENGGKSDALNTGINISKYPYFICIDADSALQRD
SLREIVAPVIEDDTVVAVGGLIRPANGITLKDGRIQTYSLPHKLIPAMQVLEYDRSFLSA
RILLDQFNGNLIISGAFGMFRKDMVVAIGGYDPTTVGEDMELVTRLHVFCRGNDIPYRIR
YAPDAICWSQAPENLSGLIRQRRRWHTGLFEVMTKHARLFANFKFGTIATLSYTYFLIYE
LLSPVIELFGILTVIIAFLFNFINVPFMIVFFMIYAVFGAVMSLTAFFSRVQTRDLRLTV
PDVIRAVVLSIFEVTIMRFILAVVRMLALVGYRKRKNVWERADRTELRAS

Enzyme Prediction     

No EC number prediction in MGYG000001538_01471.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	62	326	3.3e-25	0.9739130434782609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.13e-62	64	279	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	2.12e-56	12	465	9	425	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	1.02e-48	61	407	55	354	N-glycosyltransferase; Provisional
PRK14583	hmsR	5.55e-30	62	368	77	351	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
cd04192	GT_2_like_e	6.77e-26	64	325	1	226	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAN78238.1	1.18e-229	5	469	7	471
CBL04658.1	1.76e-227	4	469	8	473
QUO31269.1	4.59e-175	11	459	8	456
QNK56534.1	2.55e-167	15	467	12	464
QIB55150.1	1.75e-155	7	467	4	464

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9RQP9	7.06e-28	22	335	6	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=icaA PE=3 SV=2
Q5HCN1	7.06e-28	22	335	6	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain COL) OX=93062 GN=icaA PE=3 SV=1
Q6GDD8	7.06e-28	22	335	6	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=icaA PE=3 SV=1
Q7A351	7.06e-28	22	335	6	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain N315) OX=158879 GN=icaA PE=3 SV=1
Q99QX3	7.06e-28	22	335	6	277	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000012	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
10	41
339	361
365	382
389	411
426	448