CAZyme Information: MGYG000001539_00101

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_00101
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370		43631.55	4.7936

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 47087; End: 48199 Strand: +

Full Sequence      

MVLVEKIRGVNFGNWLVLEKWMHPELFAGTTAEDEDELCRQLPREELVRRLTEHRDTYIT
KDDFLYVREHGMNMVRIPVPHFIFGDDPAYCDPYVPCIEYLDRAFDWAEETGLQILVDLH
TAPESQNGFDNGGICGVCKWAQSPERIDRVLLVLEKLAERYGKREGLWGIELLNEPISEQ
LWHHIQDRYLPHDPQRATGSDFVPLSVLQDFYKRGYEVLRRHMEESKAVVFHDGFRFDAW
FNFMTEPEYKNVVLDAHWYLGMDLGSNLEELDFMRTIFHDHAEKLKLMEQVHPVIVGEWC
LCHDSQSKRERTPLQEELFFRLVGDAQLAVWEDCSGYFFWSYKLISDPAGWDLRKCIERG
WLPQNLTTGR

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	54	343	1.3e-104	0.9933774834437086

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	6.02e-27	2	364	13	383	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.89e-08	54	311	20	248	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS79423.1	6.99e-135	4	365	1	369
QRT49144.1	2.18e-130	6	364	2	387
AWY98291.1	8.99e-126	7	368	3	391
QQR01615.1	3.17e-123	7	363	3	386
ARE65151.1	3.17e-123	7	363	3	386

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	4.10e-112	6	363	2	387	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	3.30e-111	6	363	2	387	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1CZ1_A	5.09e-39	7	367	9	383	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PF0_A	5.70e-39	7	367	15	389	ChainA, Hypothetical protein XOG1 [Candida albicans]
2PB1_A	5.70e-39	7	367	15	389	Exo-B-(1,3)-Glucanasefrom Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B8N151	2.82e-52	5	363	29	393	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	2.82e-52	5	363	29	393	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q5B5X8	5.54e-52	3	367	25	395	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q0CR35	2.90e-50	5	363	38	403	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=exgA PE=3 SV=1
B0XN12	1.23e-47	7	367	42	407	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_00101.