CAZyme Information: MGYG000001539_00874

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_00874
• CAZy Family: GH116
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
677		77404.6	4.7514

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 168680; End: 170713 Strand: +

Full Sequence      

MERISWKPEERRGLVAGNASISGDVSPRGRLFQRIVWNPPCFEDGRNGMREGGESGFLIT
AGGKTKKDVELSWTVLERDYPRYRAKAQVLSELSVEVCAFAPLAPGDTEPMFLPSLLVSL
SFEGETAEEVAVTWAWKPTREMLEGSYSAPVCLQKEAGCFRAERGDAFLELSGGEMGGLG
PCGRSGLFSVETSFRMQGKRRVQAMLGYFPKEHRFRIHAESTGSLCGRLRQEFPHLEEQV
EEWILSLPQVGDEQILRYTRWYSQAAVMLTKSDVTGRVITMGYHELNQRDSFWTSFVHLS
FWPKLEQAMLRESCLWQREDGKLPTTILPKYERETDVDINEYFCLRIARYFHWHRDLPFL
RECWPHFCRSVEFLLTLDRDGDGLPEQAPPENPLCFWADWKDVKGIVGRKLAPHFVLLWL
AVLQEGILLSQALESEKSEAWFRELFQRAKAQTELPVQEGGLWQGDHYTELWYDGREISS
VLQDQTVGMAFGVVEEERAGAIWQALSRGENEGGIPETYPFREEMEYEPGVYHNGGIWPY
LTFCDCMGRYRMGAWEDAERLIRKTGRYDLEVPGDFAPNEYLHGITLENCGFEIQGWSSA
LFGTLTHGAFTVERPDELSAVIHVNFPERDFATRLLLPEPVGTILVGRRDGVLFHSDPEL
EWASVQVTERPMDAGWE

Enzyme Prediction     

No EC number prediction in MGYG000001539_00874.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH116	335	489	7.3e-16	0.3884297520661157

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3408	GDB1	1.80e-15	266	600	259	597	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam04685	DUF608	1.81e-12	283	488	11	236	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.
COG4354	COG4354	6.13e-10	292	567	365	673	Uncharacterized protein, contains GBA2_N and DUF608 domains [Function unknown].
pfam06202	GDE_C	0.004	347	451	93	204	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANH81218.1	8.83e-112	2	608	18	606
QUT52127.1	8.07e-111	18	613	42	617
QCY58135.1	1.13e-110	18	613	42	617
QJE29784.1	1.13e-110	18	613	42	617
QUR48358.1	4.43e-110	18	613	42	617

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_00874.