CAZyme Information: MGYG000001539_01244

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01244
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
809		93239.42	4.9958

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 270596; End: 273025 Strand: -

Full Sequence      

MIRQMLQENWTVNPVGSRERLPATVPGSVYADLLNNGKLEDPYWRDNELAALKVMEQDYE
YRLRFTPAAGVWSCRRQMLRFEGIDTVADLFLNGSPLGHTENMHRIFEFEVTGKLLKGEN
ELLAVLRSPTRFIREQYEKSPADGSSDAMKGFPSLRKAHCMFGWDWGPRLPDAGLWRPVS
LLGIDGGRIESVQVRQKHREGSVELFLTPQFDYVGEEPLTYTAELFSPDGTVETAEDSSG
IIEVANPKLWWPHGYGEQPLYTLKVTAYAGDREADCWQRRIGLRTVTVRREPDEYGESFA
HEVNGVQIFAMGADYIPEDNLLSRVTPERTRKLLEQCTAANFNCIRVWGGGYYPDDAFYD
ACDELGLLVWQDCMFACAVYNLSPEFAENVRMEIEDNAKRLRHHASLALWCGNNEMEMFV
DEGMWVRTPRQKADYIRMYEYLIPKAIRRQDPDTFYWPASPSSGGAFDKPNDPARGDVHN
WDVWHGFAPFSEYRKHSFRYLSEFGFESFPCLKTVETYTLPEDRNLFSYVMEKHQRCERG
NALTMAYLQQMFRYPTSFETALYASQLLQGEAIRYGVEHFRRIRGICMGAIYWQLNDCWP
VASWASIDYTGRWKALHYYAKRFFAPVLLSCCEEGMLTQNTNVNAEPYKMEKSVRFSVSN
ETMEDHACTVRWSLRDRSGHILREETVSLVAPKLQSVWLDKVELPEADPFRSYVSYELLI
SGVRTSGGTVIFSLPKYFDYPDPILCCRVEGEEIVVTAKAYAKSVEIQNEEEDLLLSDNY
FDMDPGENRVKVLSGKTDGIRLRSVYDIR

Enzyme Prediction     

No EC number prediction in MGYG000001539_01244.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	688	5.1e-104	0.6702127659574468

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.20e-99	3	662	12	680	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	9.75e-15	61	415	113	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam17786	Mannosidase_ig	7.85e-12	654	737	3	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
pfam00703	Glyco_hydro_2	1.98e-10	188	284	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17753	Ig_mannosidase	2.74e-09	753	807	16	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE97789.1	0.0	1	809	15	837
QIB54534.1	0.0	1	809	1	823
QMW79049.1	0.0	1	809	1	823
QQQ93614.1	0.0	1	809	1	823
AEF82182.1	0.0	1	809	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	3.93e-154	5	794	10	817	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.16e-154	5	794	12	819	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.27e-154	5	794	12	819	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
6BYE_A	5.95e-154	6	809	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	6.12e-154	6	809	8	848	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1D911	1.99e-122	25	799	32	834	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	1.99e-122	25	799	32	834	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	7.66e-122	25	799	32	834	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
A1CGA8	1.77e-118	25	799	32	834	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1
Q5B7W2	2.36e-118	3	795	6	828	Beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=mndB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_01244.