CAZyme Information: MGYG000001539_01514

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01514
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1034		116357.18	4.542

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 600812; End: 603916 Strand: +

Full Sequence      

MSSQTIFHEDPSVLHVGCAPERSYYLPCRNAAEALEGTSSRILSLNGDWAFRYYDSFLDA
MGAGGEDFLCFDEEEMDVIPVPSCWQNHGYGTHQYTNVNYPFPCDPPYVPDENPCGLYVR
HFERTAEDLALRQFLNFEGVDSCLYLWVNGIFAGYSQVSHSTSEFEITDLLQTGDNTLIA
LVLKWCDGSYLEDQDKLRMSGIFRDVTLISRPQNFLRDYFIKESFAADYSSAALTVDLTP
EGDVRVAGVLYGPDGTELGRAVSGSALSFQIEAPVLWNAEEPAQYTLLLETGEEAILQKV
GLRKIEIRDGIVLLNGTPIKFRGVNRHDSDPVTGYTISREQALTDLALMKRHNINAIRTS
HYPNAPWFLQLCSEYGFYVIAEADVECHGVAQAYGAHSMEAYADLADDPRFRDAILDRVK
RSVLRDKNNASALIWSLGNESGFGENFENAGRWVKEFDPSRPVHYENFLTYHSDRKPDFS
MIDLFSCMYASVDFVDAYFAPWPEGKPFGQFANSESIPESLRWQLERLQKVDRSAFYCED
GVHKKPFIQCEYIHAMGNGPGDAEDYQQRIMDYDGFCGGFVWEWCDHAVYGGQTPANRPI
YRYGGDFGEFPHDGNFCMDGLVYPDRTPHTGLLEYKNCIRPVRACRSSRPDAFRFHNFLD
FTATGEFLEISWEASQNGETLLGGVLELPSIPPHGETEVQISGLPDSGLSTITFFYTASQ
DNPFWEAGHLLGFDDIVLSEEPLPQPALTPGVLTLEEDPRRIMVSGGSFRYEFDRSSGLF
SSMVLKNRSFLEKPMEWNIYRAPTDNDRNIDLAWRQAGYDRSTVKVYESSASLTNAGTAV
ITCRLGLAAISIRKFLDITARWEIDGSGMIRAEFACNRDPRFPFLPRFGVRLFLPKAFST
AEYLGYGPCESYLDKHRASRLGVFAGEVSSLHEDYIRPQENGSHCGCRYVTLTDGASALT
ALSPTPFSFNASPYTQEELREKKHNYELEPDGSTVLCLDYKMSGVGSNSCGPALLPQYQL
REEAFSFCFTLLPE

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	33	921	7.9e-195	0.9720744680851063

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09525	lacZ	0.0	9	1031	18	1024	beta-galactosidase.
PRK10340	ebgA	0.0	9	1033	5	999	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.23e-139	31	922	1	807	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02836	Glyco_hydro_2_C	1.67e-101	305	642	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
smart01038	Bgal_small_N	3.91e-87	765	1031	1	272	Beta galactosidase small chain. This domain comprises the small chain of dimeric beta-galactosidases EC:3.2.1.23. This domain is also found in single chain beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB39630.1	0.0	1	1033	1	1005
ANU53693.1	0.0	1	1033	1	1005
QQR28924.1	0.0	1	1033	1	1005
QHQ61113.1	0.0	5	1031	4	1023
ACL74542.1	0.0	7	1033	6	1014

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	1.56e-177	9	1031	5	979	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.61e-177	9	1031	6	980	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6ETZ_A	9.64e-169	17	1031	22	985	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB [Arthrobacter sp. 32cB],6H1P_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB - data collected at room temperature [Arthrobacter sp. 32cB]
6SEB_A	1.69e-168	17	1031	43	1006	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB in complex with IPTG [Arthrobacter sp. 32cB],6SEC_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cBon complex with ONPG [Arthrobacter sp. 32cB],6SED_A Cold-adapted beta-D-galactosidase from Arthrobacter sp. 32cB in complex with galactose [Arthrobacter sp. 32cB]
6ZJP_A	4.67e-168	17	1031	43	1006	Cold-adaptedbeta-D-galactosidase from Arthrobacter sp. 32cB mutant E517Q [Arthrobacter sp. 32cB]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P70753	3.61e-307	7	1032	6	998	Beta-galactosidase OS=Actinobacillus pleuropneumoniae OX=715 GN=lacZ PE=3 SV=1
O33815	3.32e-236	7	1031	6	991	Beta-galactosidase OS=Staphylococcus xylosus OX=1288 GN=lacZ PE=3 SV=1
Q56307	8.79e-177	9	1031	6	980	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
P06864	3.51e-170	9	1033	5	999	Evolved beta-galactosidase subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=ebgA PE=1 SV=4
A4W7D2	2.73e-168	9	1030	19	1024	Beta-galactosidase OS=Enterobacter sp. (strain 638) OX=399742 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000022	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_01514.