CAZyme Information: MGYG000001539_01532

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01532
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
375	MGYG000001539_13|CGC6	42591.47	5.4588

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 626261; End: 627388 Strand: -

Full Sequence      

MLKIGIAGARGLSAMTGFQSLPEVEVAALCDLNEELLDRESKKYGIKKAFRVFEDMLADD
IDAVVIATPMQLHVAQAIAALQAGKHVLSEVTAGVSMEELWWLVETVEQSGKVYMMAENY
CYIPQVQLIQNMVDQGLFGEVYFGEGEYLHELKDLAFYQDGRVSWRSYWQLGRRGNFYPT
HSIGPVMNWMKNERIKSVICQGSGWHTAPQFRQEDTSITLCTTESGKLIKLRLDCLSERP
HNLSYYSLQGTKGCYEAPRGCGDNHKLWLKGMDAATEQARWRSLTDFYDQYLPERYKNAT
EEQKAAGHWGGDFFIIEDFVNAVTQKAANPIDVYKACEWTAVALLSELSAMNGGRAFDMP
DFHKWQRKEQQITKV

Enzyme Prediction     

No EC number prediction in MGYG000001539_01532.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	3	366	4.2e-104	0.9774436090225563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	5.00e-36	1	353	3	335	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.25e-18	2	117	1	119	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	1.49e-04	54	143	57	148	putative oxidoreductase; Provisional
pfam03447	NAD_binding_3	7.42e-04	5	114	3	114	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.
PRK00436	argC	0.002	1	89	2	99	N-acetyl-gamma-glutamyl-phosphate reductase; Validated

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEE96970.1	7.42e-201	1	375	1	374
QHW33651.1	9.42e-192	2	375	3	382
QHW35532.1	2.47e-189	2	375	3	381
QHT62446.1	2.56e-189	2	375	3	382
BBH24596.1	5.11e-182	2	375	3	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	6.59e-47	8	373	29	437	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	4.47e-38	4	362	48	433	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EVN_A	2.18e-13	25	250	31	246	CRYSTALSTRUCTURE OF putative oxidoreductase from Streptococcus agalactiae 2603V/r [Streptococcus agalactiae serogroup V]
3MOI_A	2.43e-11	2	141	3	145	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]
4FB5_A	4.43e-11	16	141	49	175	Crystalstructure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42],4FB5_B Crystal structure of a probable oxidoreduxtase protein [Rhizobium etli CFN 42]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2FLK4	2.74e-50	8	362	42	436	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
Q01S58	5.83e-48	2	369	43	436	Glycosyl hydrolase family 109 protein OS=Solibacter usitatus (strain Ellin6076) OX=234267 GN=Acid_6590 PE=3 SV=1
Q8ECL7	6.37e-48	4	362	60	443	Alpha-N-acetylgalactosaminidase OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=nagA PE=3 SV=1
A4Q8G1	7.58e-48	1	366	52	458	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4Y8C8	1.28e-46	4	362	60	443	Glycosyl hydrolase family 109 protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) OX=319224 GN=Sputcn32_2490 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_01532.