CAZyme Information: MGYG000001539_01707

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01707
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527		58876.54	4.9096

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 835784; End: 837367 Strand: +

Full Sequence      

MNTAFRGQCRLPDSITAVTGKGSFTSPGSHKLVCEDFCLSLQEKADRLTVSVTAGDTPLS
RLVLRWSLTLGQGCRILGGAWERGYGDLEWRGFVPERVMPWYFLADSGDEVFAFGVMTQP
KAMCFWTADSQGVSLHLDLRSGGEGVVLQGRRLTAAQVLFRLYEGDAFAALERFCSELCP
SPLMPDHPVYGSNNWYYAYGDSSHEEILQDASLLASLTWGLENRPYMVIDDGWQAQRTGD
FNGGPWRQGNSRFPNMAALAAEMEARSVRPGIWMRPLWNRDPEIPAEWRLQRDPEYLDPS
LPAVLDWISEDIRTLHDWGYRLIKHDFSTFDLLGGWGFQMGHVITRPGWHFGDGTKTTAE
VVLGLYGAILRAAGDSLVLGCNCMGHLGAGLMHLNRTGDDTSGVLWERTRQRGVNTLAFT
LPQHGSFFAIDADCVGITGKIDWELNRRWLQLLSESGTPLFVSIRPGVLSQEQEGEMRAA
FSKASLGESRAVPLDWQDTTCPRRWDLSGREETFDWMPDAGTVFLEL

Enzyme Prediction     

No EC number prediction in MGYG000001539_01707.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	95	328	7.8e-22	0.3691860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	4.23e-36	188	481	2	294	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	4.04e-12	94	353	192	477	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd14790	GH_D	3.75e-04	195	437	8	206	Glycoside hydrolases, clan D. This group of glycosyl hydrolase families is comprised of glycosyl hydrolase family 31 (GH31), family 36 (GH36), and family 27 (GH27). These structurally and mechanistically related protein families are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively. They have a wide range of functions including alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase, alpha-N-acetylgalactosaminidase, stachyose synthase, raffinose synthase, and alpha-1,4-glucan lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SNU96820.1	1.16e-189	10	524	9	530
ANE49069.1	1.92e-186	61	526	9	483
BDA09953.1	1.94e-186	35	524	35	533
QIB59833.1	8.98e-185	35	524	35	533
CBL19648.1	7.97e-184	11	521	30	544

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999708	0.000301	0.000017	0.000002	0.000001	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_01707.