CAZyme Information: MGYG000001539_01779

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_01779
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
232		26607.35	4.5562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 53477; End: 54175 Strand: +

Full Sequence      

MKLLRWIRNLFAALLVVGICAVAVLVWQGYSMYSKAVSETPVSRMVEEVREKENYTPLED
LPAIYRDAVISVEDHRFYEHGGFDFLATGRALWNDIKTLSLAEGGSTITQQLAKNLYFTQ
EKKFTRKIAEVFLALELENKYSKEEILELYLNSIYFGNGCYTVREASLSYFGKEPSEMTD
YESTLLAGIPNAPSVYDLTENPDLAMQRQRQVVEQMVKYEYLTQQEAETILA

Enzyme Prediction     

No EC number prediction in MGYG000001539_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	48	217	5.3e-63	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.18e-82	40	217	3	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
TIGR02074	PBP_1a_fam	1.27e-76	55	229	4	178	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	4.98e-71	1	232	8	256	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	1.20e-69	1	228	2	242	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
PRK13481	PRK13481	7.11e-51	49	232	41	230	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB42272.1	1.57e-96	2	230	9	237
ANU54501.1	1.57e-96	2	230	9	237
QQR31552.1	1.57e-96	2	230	9	237
QNM09777.1	5.40e-88	4	231	14	241
QUO38940.1	1.57e-87	18	231	19	232

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.52e-39	51	228	18	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	6.02e-39	51	228	18	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.27e-36	46	224	47	234	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.35e-36	46	224	11	198	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.39e-36	46	224	12	199	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P38050	1.95e-41	53	229	65	243	Penicillin-binding protein 1F OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpF PE=2 SV=2
P70997	1.59e-40	51	231	72	252	Penicillin-binding protein 2D OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpG PE=2 SV=3
Q4L7I0	2.43e-39	8	232	40	265	Monofunctional glycosyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) OX=279808 GN=mgt PE=3 SV=1
O87579	1.39e-38	51	231	66	246	Penicillin-binding protein 1A OS=Neisseria lactamica OX=486 GN=mrcA PE=3 SV=1
Q5FAC7	4.83e-38	51	231	66	246	Penicillin-binding protein 1A OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=mrcA PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999935	0.000012	0.000025	0.000000	0.000000	0.000061

TMHMM  Annotations     

start	end
7	29