CAZyme Information: MGYG000001539_02364

Basic Information

• Species: Acutalibacter timonensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Acutalibacter; Acutalibacter timonensis
• CAZyme ID: MGYG000001539_02364
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
746		82672	4.6861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001539	3671397	Isolate	not provided	not provided

• Gene Location: Start: 671932; End: 674172 Strand: -

Full Sequence      

MDIKKLVAEMTLEEKAAMCAGSDFWHTKGVERLGVPSVMVTDGPCGLRKQAGESDHLGLN
ASVTAVSYPTGSCIASSFDRELIQRSGEILGEECQAEDVAVLLGPAVNIKRSPLCGRNFE
YFSEDPYAAGEMAAAYIKGVQSKQVGTSLKHFAANSQEHRRMTSDSVVDERTLRELYLPA
FEKAVKEAKPWTVMCSYNKLNGTYASENHRLLTEILREDWGYDGMVVSDWGAVNDRVKGV
AAGMDLEMPGPGKENATKITEAVLSGTLSEEDLNKAVERVLKVVAQYIENRQPNTAFQYE
RDHEMARQMAAESMVLLKNEAGILPLSKEKKVAFLGEFAKHPRFQGGGSSHVTCYKITGA
VEAAKDLNIVYAPGYSIESQEPQEELLAEAVKAAKEADCAVLFIGITDEMESEGFDRKNL
KIPFGQQRLIEEVVKVQKNTIAVIHCGAPVEMPWLNDVKAVLYAYLGGEAVGSAVVDLLY
GEKNPSGKLAETFPLRLEDNPSYLYYFGEGDLTEYREGIFVGYRYYDKKDMEVLFPFGYG
LSYTEFAYSSLRLDRDSLKDTDSLHVSVKVENIGNRAGKEIVQLYVQDNESSVIRPVKEL
KGFEKVELAPGEEKEVSFTLDKRSFAYYNTEISDWDVETGDFTIMIGKSSRDIALSAVVR
VESTRQYKRVFTINSTFGDIMADPKGQEIVSKMLEKMNLDDIGGEAISKDAMMAMMGYMP
LRGALMMGGDKIRPEMIEGLLDQLNA

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	28	249	7.1e-69	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.30e-103	68	653	120	757	beta-glucosidase BglX.
COG1472	BglX	3.31e-73	23	353	48	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	8.51e-60	314	543	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	1.89e-57	6	647	56	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.06e-37	32	283	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASB41189.1	0.0	1	746	1	750
ANU55573.1	0.0	1	746	1	750
QQR30463.1	0.0	1	746	1	750
QUC66582.1	0.0	1	745	1	753
QUA52387.1	0.0	1	746	1	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.47e-303	1	745	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.02e-201	7	738	9	741	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.68e-142	2	668	5	843	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.66e-138	2	668	5	843	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.03e-136	3	668	4	720	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.67e-303	1	745	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.02e-191	7	738	9	750	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	4.03e-191	7	738	9	750	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q2U8Y5	7.77e-146	1	667	4	836	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	1.09e-145	1	667	4	836	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999314	0.000725	0.000004	0.000001	0.000001	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001539_02364.