CAZyme Information: MGYG000001540_00416

Basic Information

• Species: Corynebacterium provencense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium provencense
• CAZyme ID: MGYG000001540_00416
• CAZy Family: GH23
• CAZyme Description: Resuscitation-promoting factor Rpf2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387	MGYG000001540_1|CGC2	40313.89	4.7008

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001540	3078120	Isolate	not provided	not provided

• Gene Location: Start: 455372; End: 456535 Strand: -

Full Sequence      

MSPKNKSTLHRINHTSSVPLRVATGGMLATLVVGGAVVATNHKDVTLDVNGRIIKASTVS
GDVREILDSEKVRYSDADLITPGLGESVSDGSRVTVRSARQVALVVDGQSKTVATTSTTV
SDLLNELGYSGTATTAGASGIPLDGMELTITSPKSFTLNDGNPWEAPARLTMAARTVADV
LEMRGTPLGKDDVVTPSADTPVTEGMHIDVSRFTSEEVTEEQPVEPAVRVEEDPELDQGT
EQVISEGTVGSARVTVRIQKLNGVETAREVLRSEEITPASERVVRRGTRVAPVASSASAS
APSVAGGSVWDSLAQCEAGGNWATNTGNGFSGGLQFTPSTWAAYGGTAYAPEAHMATREQ
QIAVAEKVQASQGWGAWPACTSKLGIG

Enzyme Prediction     

No EC number prediction in MGYG000001540_00416.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3583	YabE	7.47e-71	4	327	2	309	Uncharacterized conserved protein YabE, contains G5 and tandem DUF348 domains [Function unknown].
pfam06737	Transglycosylas	5.21e-42	308	380	3	75	Transglycosylase-like domain. This family of proteins are very likely to act as transglycosylase enzymes related to pfam00062 and pfam01464. These other families are weakly matched by this family, and include the known active site residues.
cd13925	RPF	3.57e-30	308	380	1	71	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.
pfam07501	G5	2.19e-19	216	289	2	75	G5 domain. This domain is found in a wide range of extracellular proteins. It is found tandemly repeated in up to 8 copies. It is found in the N-terminus of peptidases belonging to the M26 family which cleave human IgA. The domain is also found in proteins involved in metabolism of bacterial cell walls suggesting this domain may have an adhesive function.
cd00442	Lyz-like	2.31e-06	309	367	1	58	lysozyme-like domains. This family contains several members, including soluble lytic transglycosylases (SLT), goose egg-white lysozymes (GEWL), hen egg-white lysozymes (HEWL), chitinases, bacteriophage lambda lysozymes, endolysins, autolysins, chitosanases, and pesticin. Typical members are involved in the hydrolysis of beta-1,4- linked polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT25682.1	1.94e-269	1	387	1	387
AGP31289.1	6.29e-202	1	386	1	379
AEK37403.1	1.27e-193	4	386	2	375
AHW63439.1	3.67e-171	1	386	1	382
AHI03635.1	3.87e-155	1	386	1	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5E27_A	7.96e-63	133	385	4	246	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],5E27_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]
3EO5_A	2.14e-45	210	385	1	169	ChainA, Resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
1XSF_A	7.23e-34	276	385	4	106	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4EMN_A	1.43e-30	307	385	1	79	ChainA, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_B Chain B, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_C Chain C, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis],4EMN_D Chain D, Probable resuscitation-promoting factor rpfB [Mycobacterium tuberculosis]
4KL7_A	7.35e-30	308	385	1	78	ChainA, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KL7_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_A Chain A, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_B Chain B, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_C Chain C, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis],4KPM_D Chain D, Resuscitation-promoting factor RpfB [Mycobacterium tuberculosis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6M6N7	4.72e-103	1	386	1	373	Resuscitation-promoting factor Rpf2 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=rpf2 PE=1 SV=1
A0R3E0	2.67e-79	20	385	2	360	Resuscitation-promoting factor RpfB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=rpfB PE=3 SV=2
P9WG28	5.32e-79	20	385	2	360	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=rpfB PE=3 SV=1
P9WG29	5.32e-79	20	385	2	360	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpfB PE=1 SV=1
H8EZH5	5.32e-79	20	385	2	360	Resuscitation-promoting factor RpfB OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=rpfB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.580393	0.405296	0.013087	0.000351	0.000260	0.000603

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001540_00416.