CAZyme Information: MGYG000001540_00421

Basic Information

• Species: Corynebacterium provencense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium provencense
• CAZyme ID: MGYG000001540_00421
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		59751.67	9.6299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001540	3078120	Isolate	not provided	not provided

• Gene Location: Start: 461633; End: 463240 Strand: +

Full Sequence      

MKQSATVAHRPGTGTTRRASPFRGAALRAVTRWNIILCVLALLGAVTRLTELGYPTDDGT
PVFDEKHYVPQAWQILRGADNPVVGGIEDNPAYGLVVHPPLAKQLEALGMAVFGDTAFGW
RVVAALLGIGVILLTASTARRIARSTGHGDWVGLSAGLIALCDGILFVTGRSAMLDQFQT
FFVILAAYLLVRDHEQMEGLFRRVFTEGRVSDSPLGPRAGYRWWRFAAGVSLGCALAVKW
SGLYYMAFFGLAVVGVDWWRRRRFGVQRPLAGVFALDCVPAFASLVLLPAVVYVLDWRAW
FASETGVFRHEAESGNERIASWGLGWLPDSWLNFIYYHVSVLDFHEELTNSNGHHHPWES
KPWDWLASTRGLLYFSETDTGGMKHVVLLTGTPAVWFLAVPVMLWGLWSLLRRRDMRWLV
PVVGYLAGFLPWLVNTDRQMYLFYATNLAPFLIIGLALALGQLAGRSLVKDRDAAPQAGM
VAGIRHLFLTRTGLMVGVVYLVIVVWMFLFFLPVFSGLPLTETQWRWRMWLPGWT

Enzyme Prediction     

No EC number prediction in MGYG000001540_00421.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	40	301	4.4e-64	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	1.84e-40	27	534	33	693	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	1.70e-17	98	466	136	415	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	1.77e-14	39	295	2	235	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam16192	PMT_4TMC	7.19e-13	333	532	2	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG1807	ArnT	1.46e-08	64	484	34	419	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT25677.1	0.0	1	535	1	535
AEK37413.1	0.0	31	535	13	514
AGP31294.1	0.0	31	535	17	521
AHW63433.1	2.61e-271	32	535	24	529
QQC48610.1	7.83e-240	36	534	1	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	1.21e-06	34	258	50	253	Structureof S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	1.29e-162	14	534	19	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	7.65e-135	35	534	45	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	7.65e-135	35	534	45	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	1.01e-133	39	534	43	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P33775	6.62e-06	34	258	50	253	Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999829	0.000187	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
33	50
117	139
151	170
174	191
231	253
273	295
386	408
418	435
442	464
496	518