CAZyme Information: MGYG000001540_01522

Basic Information

• Species: Corynebacterium provencense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium provencense
• CAZyme ID: MGYG000001540_01522
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		44506.77	9.7238

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001540	3078120	Isolate	not provided	not provided

• Gene Location: Start: 225028; End: 226242 Strand: +

Full Sequence      

MEEIWDHRADLAEQAVLERHVTRLWGIPKTSLAVIAWPPTTRDKFFYHWHCWWQAQFIDC
QVDAATRRATGRRLRRIRRTVRAVRIRNRRALPHNEFYDDRAWLALAMHRAGELPKYGSV
RYLPGLCSSLLDGIDPLTGVLPWRDGQDFFNVTTNGPAAILAARTGRRDLTGQFVEWVYP
RLINADGLVTDGVRLRLHGEEQVPRVHTVNQGLVLGALVELARSLRKDAGVPMGAVSEVG
TRCLTRVHQLVQAVATHMATTDGIIDTGDTGDPGLTGWQGNGGGDGGLFKGVLARYLALV
ATGLPSDDRLSRATRQLARRLVLQSAESVWHHRLEVDGLPLFGASWVRDAALPRTGGRIG
TALASGPGADLGVPERDLSVQLSGWMLMEAAVRVTGGVVRDSTD

Enzyme Prediction     

No EC number prediction in MGYG000001540_01522.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	36	349	9.1e-61	0.8212290502793296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	3.39e-105	8	391	2	367	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	3.98e-10	95	331	83	315	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT27099.1	6.50e-288	1	404	1	404
AEK35746.1	4.08e-216	1	396	1	391
AGP29959.1	4.38e-211	1	397	1	389
AHW65272.1	3.43e-167	1	395	1	382
QQC46704.1	2.08e-162	1	394	1	381

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	6.45e-15	6	390	49	385	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	1.21e-13	6	390	50	386	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
3K7X_A	2.28e-13	5	346	3	314	ChainA, Lin0763 protein [Listeria innocua]
6SHM_A	6.91e-13	6	390	50	386	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000053	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001540_01522.