CAZyme Information: MGYG000001540_01744

Basic Information

• Species: Corynebacterium provencense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium provencense
• CAZyme ID: MGYG000001540_01744
• CAZy Family: GT2
• CAZyme Description: Bifunctional apolipoprotein N-acyltransferase/polyprenol monophosphomannose synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
256	MGYG000001540_2|CGC5	28156.17	7.2684

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001540	3078120	Isolate	not provided	not provided

• Gene Location: Start: 462544; End: 463314 Strand: -

Full Sequence      

MVIPSLDEQHNLTVLLPRLPRTPDGLEVIVVEGGDLERTRTLVDRLCPEATVVPQARIGK
GNALVTGVSVARGDYVVLLDADCSADPSEIPAFTAALDAGADMAKGSRYLDTGGSLDLTG
LRSLGNRGLSAVFNILFRRRFTDLCYGYNAFRTSSFPLLGLPDPRTPAEKMWGDGFEIET
LFTCRAAAAGLRITEVPSLERRRLHGRSNLNAWSDGWRVLFTLLREWAGTVLQVSDDHLP
RIRGWMPRAPGQHTFR

Enzyme Prediction     

No EC number prediction in MGYG000001540_01744.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	2	119	2.2e-18	0.7294117647058823

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04179	DPM_DPG-synthase_like	6.85e-36	2	186	2	185	DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily.
cd06442	DPM1_like	1.09e-32	1	225	1	223	DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily.
PLN02726	PLN02726	7.98e-21	1	212	13	226	dolichyl-phosphate beta-D-mannosyltransferase
cd04188	DPG_synthase	2.99e-17	2	197	2	201	DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate.
pfam00535	Glycos_transf_2	8.01e-15	2	156	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT27471.1	6.49e-188	1	256	47	302
ALL75929.1	6.87e-76	1	227	27	256
ALL82956.1	6.87e-76	1	227	27	256
BCJ37395.1	1.29e-75	2	227	1	230
QIG43551.1	1.42e-75	1	227	24	251

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O70152	3.26e-14	1	210	29	241	Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus OX=10090 GN=Dpm1 PE=1 SV=1
Q9WU83	9.11e-14	1	210	35	247	Dolichol-phosphate mannosyltransferase subunit 1 OS=Cricetulus griseus OX=10029 GN=DPM1 PE=2 SV=1
Q9LM93	1.84e-13	1	210	17	227	Dolichol-phosphate mannosyltransferase subunit 1 OS=Arabidopsis thaliana OX=3702 GN=DPMS1 PE=1 SV=1
A5GFZ5	2.98e-13	1	210	28	240	Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa OX=9823 GN=DPM1 PE=3 SV=1
Q9VIU7	8.44e-13	1	210	10	222	Dolichol-phosphate mannosyltransferase subunit 1 OS=Drosophila melanogaster OX=7227 GN=Dpm1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001540_01744.