CAZyme Information: MGYG000001540_02592

Basic Information

• Species: Corynebacterium provencense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Mycobacteriales; Mycobacteriaceae; Corynebacterium; Corynebacterium provencense
• CAZyme ID: MGYG000001540_02592
• CAZy Family: GT87
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		46137.52	10.7076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001540	3078120	Isolate	not provided	not provided

• Gene Location: Start: 1365723; End: 1367015 Strand: +

Full Sequence      

MNIAASFPRISGRARQVLRPLTVVLITAAVVYTAVRFVVGPGGVVYHIDFDVYRSGGHAV
LDSVPLYQGSFRVGGITLPFTYPPLSAVTFVPLALMPLWLGEVVFTVVSVVALLLTAVIT
LRSLSRESGDILPRHRLWTTAGVVTAAGVFAWPVVSTLEYGQINIVLMLLVAADLLLPRT
PWPRGMLVGLAAALKLTPAVFGLFFLLRRQWKDAATSVISGLAFTALAWVILPADSLRYW
TETVSDPTRIGGLMYSANQSWRGAVARFTDDPLQTRIWVTLAVVTVVAVTVVMYRQLSVG
ATTAAVCTNALLGLLASPVSWAHHWVWVVPMAVVAVASACRAGTGQVRRAAVFLAVVVTV
VPVLLVVHTWFPSTHDVERTWSVAMKILGSELVLTGVCWLVIGGLLPRATRPAPRADART
EPGAAPVPST

Enzyme Prediction     

No EC number prediction in MGYG000001540_02592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT87	80	318	4.4e-74	0.9956709956709957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13375	pimE	4.07e-46	4	325	3	316	mannosyltransferase; Provisional
pfam09594	GT87	1.86e-32	80	318	1	237	Glycosyltransferase family 87. The enzymes in this family are glycosyltransferases. PimE is involved in phosphatidylinositol mannoside (PIM) synthesis, a major class of glycolipids in all mycobacteria. PimE is a polyprenol-phosphate-mannose-dependent mannosyltransferase that transfers the fifth mannose of PIM. The family also includes alpha(1-->3) arabinofuranosyltransferase, invloved in the synthesis of of mycobacterial arabinogalactan.
COG5650	COG5650	3.73e-04	64	232	134	287	Uncharacterized membrane protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWT26452.1	4.72e-301	1	430	1	430
AEK36498.1	6.47e-172	24	414	5	391
AHW64408.1	1.17e-141	11	412	8	413
AGP30563.1	1.54e-138	35	414	43	418
QQC48427.1	3.81e-98	5	430	8	434

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R036	1.86e-65	8	422	10	430	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4247 PE=1 SV=1
P9WMZ8	9.70e-61	8	334	7	340	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT2236 PE=3 SV=1
P9WMZ9	9.70e-61	8	334	7	340	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol mannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2181 PE=1 SV=1
A0R2K8	7.21e-41	11	331	25	334	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=pimE PE=1 SV=2
P9WN00	1.41e-37	48	384	69	398	Polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pimE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000010	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
21	40
99	121
141	163
185	207
214	233
275	292
297	316
321	343
350	372
387	409