CAZyme Information: MGYG000001541_01356

Basic Information

• Species: Murdochiella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Murdochiella; Murdochiella massiliensis
• CAZyme ID: MGYG000001541_01356
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
684		77901.26	4.9435

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001541	1642295	Isolate	not provided	not provided

• Gene Location: Start: 1142578; End: 1144632 Strand: +

Full Sequence      

MQEKKYERSLAKALLLSAGVLALPIGIAHAETADLPVVQSEVDTQYDVGRFVDDVVETTQ
DASSEEVKAAQGSETEMAHESASETEQKQSEEKPETSATEQGKEQELAAAAQEALKQKQP
LFAEGIGDVIEIAEETQQENETEKENSEQNAEKQENESSDVAVTAKSAERKEAVGTKYIS
RIAPPDTCRTAHLVEGQFYDADNQPILNRWVEHQNQFYFVNSRGYCYTRRFISFGGNSIY
YLNGQGQQMTGVLTLGEKKYLLDEKTGILRRDNAWVDQMAGRYFPNADGELYYNRFIYFG
ERGTYFMGEDGTKRTGTVRFQNKLYQLNNVTGKLEQEYKPGYHMINGKRYYVDEQGNMKE
AKGTAGWVIKDGKNYYVKADGTVYRNRQISFGDTYYYMDENGASTDGIHEVDGRYYFYDP
ANNNVRRHTKGILSWKGNRYYIGTRGYIVTNQPVQVGDGLMEADDTGKLVPTNRLLVIDL
STHQKPKNFDFDAFSRGISGVILRAGYTGHGTGDYYEKDEEFERFYKEFNARGIPIGAYW
YSCANEVKEGVAEAKFFQKSIAGKKFSLPVYWDTEDEYHQRKTDKKTLTDTALAFLEEME
KAGYYTGIYASSSWLRDKLEMSRLKKYDVWVAHYGVNTPSYTGDYGMWQFTSTYEKDGFP
YGVDANWMLADYPSIIRNAKKNGF

Enzyme Prediction     

No EC number prediction in MGYG000001541_01356.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	478	658	1.8e-39	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06414	GH25_LytC-like	7.93e-58	477	667	3	189	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
cd00599	GH25_muramidase	2.55e-25	477	668	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
cd06525	GH25_Lyc-like	2.38e-22	478	666	3	182	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	1.08e-19	478	658	1	179	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	1.51e-18	478	666	3	190	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96747.1	2.39e-63	478	682	6	208
QBX31317.1	2.39e-63	478	682	6	208
AMC93674.1	4.65e-63	478	682	6	208
ARP49604.1	3.51e-61	478	682	6	208
QDS38460.1	3.51e-61	478	682	6	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5A6S_A	1.80e-14	494	677	40	210	Crystalstructure of the CTP1L endolysin reveals how its activity is regulated by a secondary translation product [Clostridium phage phiCTP1]
4FF5_A	2.09e-11	477	666	54	247	Structurebasis of a novel virulence factor GHIP a glycosyl hydrolase 25 of Streptococcus pneumoniae participating in host cell invasion [Streptococcus pneumoniae]
4KRU_A	6.15e-10	478	666	23	205	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.94e-09	478	666	23	205	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49331	2.63e-10	197	459	1213	1448	Glucosyltransferase-S OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=gtfD PE=3 SV=3
P26836	9.97e-09	472	682	6	206	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000429	0.998722	0.000295	0.000193	0.000174	0.000149

TMHMM  Annotations     

start	end
13	30