CAZyme Information: MGYG000001542_00478

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_00478
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733	MGYG000001542_10|CGC4	83261.9	5.2044

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 146947; End: 149148 Strand: -

Full Sequence      

MLTEGRSEQIGDGSVMTRLQESIYDKTGADIPCALQALANRYVADNPAEPYRYRAFNREG
IQRANDFRYVFNLGDRFPEAEVGQISYAWGMMWCDHPDTEMTWLTTAWGPLEVFVNGQRI
YRSLPGDERPKIKRECRALLNAGWNDIALKFTKTRAGFGGLFGTPSSKWVIFNSIIASSE
RSGQEGWLFSKPVDEAVEELPIAGQSEFAGALQWCPHLEWTEEQQLMTPLERLYGSADGS
TAFAWSKFQANNAANRMYRIIGSSLGPTVLLIDGVEKYRCEQAGKFELEMELSYGSHQLV
IRDTAASSWGTTVTVMSGDQPVRLEQPVPVHGYSGAWLYLGPFADQYIPGKLELTELHRV
HKDGGQGTYWRADMPGAWIRPYLEAPLFGKWNYPVGVTLYGLAQMGRTLGRSDLVAYAAD
HVAQTVRWYPYTKWDYEQYKGTGINQSLADIDSLDDCGSFGSTMLELYRDHKRISGVEEL
AEVIGTYISEKQERLTDGAFYRKHGQGEDTMWADDLYMSVPFLCRYYELTGQEKYIHDAA
RQFLLFRKYLYIPEEQLMSHVYDFEQGLATGVPWGRGNGWVLFSLSELLSALPEKHPERE
ELLEMFRTLSAGYLAHQSEEGLWRQVINEPDAYLETSCTAMFIYAYARGVRNGWLTDKAA
YSNSAIQAWRGLTRHRIDARGNLFGVCRGSGYSHSSRYYKYDLLPQLNDTHGIGIVMLAG
VELQRLIEWLQMP

Enzyme Prediction     

No EC number prediction in MGYG000001542_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	386	724	3.5e-92	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.35e-61	382	726	18	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.06e-49	384	726	27	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS13703.1	0.0	1	733	40	772
AFH64064.2	1.33e-231	20	731	7	725
AEI44158.1	5.34e-231	20	731	7	725
QZN78574.1	1.62e-230	21	731	8	725
APO47440.1	3.25e-230	21	731	8	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	7.17e-45	383	728	72	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.45e-29	384	728	32	369	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.29e-29	384	728	22	359	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	8.53e-23	387	726	19	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	4.08e-20	512	725	167	378	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.34e-28	384	728	32	369	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	6.15e-19	391	721	29	335	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
P9WF04	3.20e-18	512	678	201	371	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
P0A3U6	8.20e-16	518	722	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	8.20e-16	518	722	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000007	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_00478.