CAZyme Information: MGYG000001542_01236

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_01236
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541		62862.04	5.02

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 9454; End: 11079 Strand: -

Full Sequence      

MYANNGEVIGYLRADGQRLVNGQGEEILLRGVGLGNWLLPEGYMWKFPPDKADRPRRIEK
LIHDLIGAEEASSFWTEFREHYITEQDVARMAEEGLNSVRLPINARFLLEEGEPLRFNKS
SIRLIDQFIEWCKQYKLYVILDLHGAPGGQTGANIDDSENDQPELFIHESYRKQTVQLWK
ELADRYKDEWIVGGYDLLNEPLPNYFNQYNDMLMPLYQEITAAIREVDQKHLIILEGAHW
ATDWTVFTEMFDRNILLQFHKYWSSIDTESIAPYLDKRHEFNVPIYMGEGGENTLSWYTG
AFGLYEDHQISWNFWTWKKLDTFNSPCSINKPQDWELILDYLRGGEQPDREQARVILREY
LHNIRFEHCRYQPQVLNAVQRKLPLRIPAEYYGNQGEGTSYIISQLKRSKHNPFRSSDKI
PISFIQKKEGPPNFHLKPEEEWKDEERLCIELTAGASVSYPLHCDRPGEYALFIRAAIPE
GAASLDLQLNQQPGFSLALAPSGWKVCSLEPKIHVTEGDLTLKLSASHGTVQIDWIEFSL
K

Enzyme Prediction     

No EC number prediction in MGYG000001542_01236.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	69	321	1e-97	0.9922178988326849

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	6.35e-31	78	317	20	268	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.52e-21	66	323	57	314	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
cd04080	CBM6_cellulase-like	4.75e-04	460	539	61	144	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
COG2723	BglB	0.008	57	223	40	192	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS17530.1	0.0	1	541	1	541
ANY73244.1	1.28e-226	3	539	7	543
QJD88155.1	3.51e-218	6	537	7	543
ACX62836.1	3.64e-217	3	539	4	543
QOT08908.1	1.38e-214	3	539	4	543

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1CEC_A	4.83e-20	74	338	20	335	ChainA, ENDOGLUCANASE CELC [Acetivibrio thermocellus]
1CEN_A	1.18e-19	74	338	20	335	ChainA, CELLULASE CELC [Acetivibrio thermocellus],1CEO_A Chain A, CELLULASE CELC [Acetivibrio thermocellus]
1EQP_A	4.14e-15	28	262	8	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1H4P_A	1.90e-14	29	238	13	230	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1CZ1_A	2.34e-14	28	262	8	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
W8QRE4	6.52e-40	9	262	1	248	Beta-xylosidase OS=Phanerodontia chrysosporium OX=2822231 GN=Xyl5 PE=1 SV=2
Q5B5X8	2.33e-25	29	289	29	296	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
Q8NKF9	3.26e-20	29	262	37	281	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
A2RAR6	5.43e-20	28	276	41	283	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
P23340	1.08e-19	74	338	20	335	Endoglucanase C307 OS=Clostridium sp. (strain F1) OX=1508 GN=celC307 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_01236.