CAZyme Information: MGYG000001542_01569

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_01569
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
829	MGYG000001542_28|CGC4	96643.91	5.7581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 118140; End: 120629 Strand: +

Full Sequence      

MQYESIVLPQNYTVPYRLLIHQVRVVPYHWHDFIEIIFVIKGSIKLEVEKQEMMLSEGEV
AIVNSCYRHSIQSLTTQNIVCALQIREDFLRSEMECFDSLTFGMAHQTTANDIALMKRYL
SELALLDIKKKRNTPILRKVKILEILNLIEQRFSREKQEPEGALSLDRKITDILLYINNN
IAEPLTLEDTAREFNMSPAYLSKLFKKSFGINMMTYIFEYRLQLVCSDLVITDRKISDII
FSRGFNSISSFNDRFKKHFGMAPNQYRSQNKQGLAIKEEDITHSLYNYINLMKEDSLTEL
FSPEHEESRFANESFHSSSYEERIIDMSGSLAPYDSSISRMIGVGRAKELLDADMQSQLA
QACKEAGLNRVRFHGIFSDDLMVYHDENGVKAYNFKYIDRIFDFFTEHRIIPFIELGFMP
NDLASGKQTMYRWEANTSQPKEIHDWTRLVGQFIRHLINRYGLAVIRTWDFEIWNEPDLE
GFYWHGTQDEYLHFFKKTYQAIKKIDSKLKVSGFSGTSWSVVNTEWTSKALKFMEENDII
LDSFTYHIYPIEWNLEATYFNLWTANRKGLYSYADSSYIVSTVKEVHQLIHAAPNVNQGR
TIITEWNSSSDPQDLLHDTVFMASFIVKNVINSVGYVDVMGFWTLSDIFDEHLLSLDTFH
GGFGLMTVEGIRKPGYYAIAYLNQLGATLVYRDEQLIVTKDDEDNYQILIHNYQEYDELY
KSFNTSHISLKNRYGVFAEEADKRLKLTLQNMYGSYTITKQQVNRTHGSAYDAWVDSGGA
EMTAEYVNYLKSISVPRMTIQKERIQGDFVFELSLEPHEIVFLKLEKTI

Enzyme Prediction     

No EC number prediction in MGYG000001542_01569.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	335	778	5e-120	0.9721577726218097

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	1.07e-83	325	821	5	485	Glycosyl hydrolases family 39.
COG3664	XynB	7.01e-54	350	829	1	428	Beta-xylosidase [Carbohydrate transport and metabolism].
COG2207	AraC	2.14e-27	149	272	1	124	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.95e-25	184	267	1	84	helix_turn_helix, arabinose operon control protein.
pfam12833	HTH_18	5.90e-21	191	269	2	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATF25933.1	3.95e-250	11	826	7	822
ATH85273.1	3.95e-250	11	826	7	822
SPN73144.1	3.18e-249	11	826	7	822
AWC31744.1	6.49e-157	2	829	4	832
AWC60019.1	6.49e-157	2	829	4	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4M29_A	1.43e-69	325	826	13	497	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	2.74e-69	325	826	13	497	ChainA, Beta-xylosidase [Caulobacter vibrioides]
1W91_A	2.88e-68	342	828	22	483	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
2BS9_A	1.46e-67	342	828	22	483	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
2BFG_A	1.02e-66	342	828	22	483	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	5.92e-67	342	828	22	484	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	7.19e-65	339	826	25	486	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
P36906	3.50e-64	342	829	22	483	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
O30360	8.38e-62	342	829	22	483	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P96660	9.64e-17	26	270	38	290	Uncharacterized HTH-type transcriptional regulator YdeC OS=Bacillus subtilis (strain 168) OX=224308 GN=ydeC PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_01569.