CAZyme Information: MGYG000001542_01708

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_01708
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
753	MGYG000001542_28|CGC8	83106.86	4.8068

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 304365; End: 306626 Strand: +

Full Sequence      

MGKQRNLKSLIAQMTLEEKASLCSGQDTWHTQGIERLGIPSVMVTDGPHGLRKQRGSSDH
LGLFDSVPSTCFPSAAGLASSWNRDLIGKMGEALGRECQAENVAILLGPGVNIKRSPLCG
RNFEYFSEDPYLSAEMAAHHIQGVQSLGVGTSLKHFAANNQEHRRMTSNSVVDERTLREI
YLASFEGAVKQAQPWTVMCAYNQVNGEFAAENQELLTDILKDEWGHQGFVVSDWGAVNER
VKGLVAGLELEMPSSNGEGTTQIVEAVKSGQLPEATLDDAVERLLNVIFKAVNQRRPDAA
FQPEEHHHLAREVARESMVLLKNEDDILPLKRSGKIAIIGAFAEEPRYQGSGSSQIRPTR
LDNPIEEMSKLAGAAALIYAKGYDLKEEESNSSLLQEALSAASEATVAVVFAGLPSRYES
EGFDREHLRIPPNQVALIEAVAGIQKNLVVVLSNGSPVEMPWLYQAKGVLEAYLGGQAFG
GAIADLLFGEANPSGKLAETFPVQLSDNPSYLFFPGEGDRVEYREGLFVGYRYYDKKQLE
PLFPFGYGLSYTSFEYSNLTVDKKNLLDSDQLRVSVDIENTGFLAGSEIVQLYIRDPDSS
VIRPDKELKGFDKVELAAGEKKTVTFELDRRSFAYYDIEIKDWAVETGTFEILVGKSSRD
IVLSETVEVQSTTERSSRFHRNSTVADMMTSEPGAVFIKKFMSMLPFASAMDPSHSEMLK
AFMEFMPLRGLVSFSGGKFTEEQLHDLLKQLNS

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	253	7.9e-69	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	7.64e-127	36	661	101	757	beta-glucosidase BglX.
COG1472	BglX	1.75e-76	29	367	50	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.29e-73	8	629	54	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	3.02e-72	318	551	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.69e-44	36	287	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYB42829.1	0.0	1	752	1	752
ANY76372.1	0.0	14	753	1	741
BBI32412.1	0.0	1	752	1	753
BAJ09393.1	0.0	1	752	1	752
QAY65793.1	0.0	1	752	1	753

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	0.0	6	753	4	753	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.60e-217	11	738	9	733	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	5.15e-143	7	669	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.98e-142	7	669	4	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	7.35e-139	6	670	5	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	0.0	6	753	4	753	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	3.51e-211	11	736	9	738	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	5.62e-210	11	669	9	670	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	3.18e-152	7	661	46	737	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
B0Y3M6	1.82e-149	4	672	3	832	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_01708.