CAZyme Information: MGYG000001542_02028

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_02028
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
587	MGYG000001542_32|CGC1	66933.31	5.1973

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 22188; End: 23951 Strand: +

Full Sequence      

MSMRQHHFHWTDGGDGVQWEITTETPEAGIELVHIRISLENPDIPPCIQLTWEHPAADIQ
GVWHPNCGRNRGFVPDWGAGYTSRLTNSSPVVCLFSGTGRNKLTFAFSDALNPIVMKAGV
HEETAEYHCAVTLFDEPVAPLSHYEATLRVDCRDLFYYEALNEVQNWWSGLPGLTPAPVP
DSAREPMYSTWYSYHQQLVPEEIEEQCRLAKKLGCESVIVDDGWQTADNLRGYAYCGDWN
VCPDKIPNMKEHVERVHRLGMKYLLWYSVPFVGMHSRAWNQFQDKMLYTIEERGWGIVDP
RYPEVREYLILIYEKALIEWDLDGFKLDFMDSFLPPGGRKPEYGNGRDYVSVSEAVDRLM
TDIMQRLRRIKPKVMIEFRQSYIGPHMRKYGNMFRASDCPNDSIENRVRTLDIRLLCGNT
AAHADPIMWSMEEPAESAALQLINALFAVPQISVRLDQLPERHQDMAAFWLSFWREHRQV
LLDGPLEPYHPELLYPVVIAAAKDILIAAAYERTVVPLNRELPKTVVLINGTRENGMIVE
WAANAGSRAVTVQDTTGRVMQEYNLGIEGVQQISVPPAGLVTLIAGK

Enzyme Prediction     

No EC number prediction in MGYG000001542_02028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	180	485	2e-35	0.45058139534883723

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.24e-75	183	476	1	299	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	8.16e-12	210	484	67	347	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
COG3345	GalA	2.06e-11	174	539	282	647	Alpha-galactosidase [Carbohydrate transport and metabolism].
cd06592	GH31_NET37	3.92e-07	184	337	1	160	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	2.36e-06	186	426	2	207	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS17022.1	0.0	1	587	1	587
CQR57728.1	0.0	1	587	4	591
QTH41069.1	2.79e-298	3	587	7	592
QGQ97599.1	4.14e-261	21	587	24	591
QJD86820.1	5.00e-253	5	583	6	600

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PHU_A	1.51e-10	80	373	252	530	SpAgawild type apo structure [Streptococcus pneumoniae TIGR4],6PHV_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4]
6PHW_A	6.00e-10	80	373	252	530	ChainA, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PHX_A SpAga D472N structure in complex with raffinose [Streptococcus pneumoniae TIGR4],6PHY_A Chain A, Alpha-galactosidase [Streptococcus pneumoniae TIGR4],6PI0_A AgaD472N-Linear Blood group B type 2 trisaccharide complex structure [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_02028.