CAZyme Information: MGYG000001542_02360

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_02360
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1183	MGYG000001542_33|CGC1	131243.28	4.559

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 49288; End: 52839 Strand: +

Full Sequence      

MTPITWKRSVILSLFVIVSLFVTSGGSSIYALENNDDVTQIPIQADTYVNAGSLANTNYG
TDPMLQVRTWSSDPNYTRESYMKFDLSSYSGEVGSVTLNVYAAVINTNGSPLAFQLYGVE
DDTWTENRVTWNEKPVIDHYLANVNVGLTWKWIQVDVTSFVKAQLASDQVASFGLTQAAQ
NGALIHINSKENAVNQPYLSLSNRRVDPSAPSWPSDASVVIENLGESGLDLKWSETQSPE
NTDSYQIFQNGKSKATVTSDTYHIPIQDLDIGSTYTFKIEAGNSQDKWSHDGPYVTVNVP
KTELKQMKIGNVFNENEPIHFKVATLLPSVTWSAYDMQGAKMSEGTAYNDRGNAIINVPY
TKRGYFKLRATAESSDQQTSVPLETSFAVLSPYDFTAVADSPFGMATHLHRGQTNTIPII
QQAGVKSVRDGIEWHAIEKSKEVYTFNPVPDNYMAQLKEQGIDMLFVSGYNNPFYDNNGT
PYTDQGREGFANYAEAYVDSYKDQLIAMEAYNEFHGSFGKRGNSPANSRPDYYFKLLKKT
YETVKASHPEFPVYGIVASEDAVSWIEEVFKLGGLQYMDAVTLHPYLYPNEPESLTESLD
QIKALIRQYNNGQDKPIWITEFGYPTHKSVNGVDEIIQANYLVRYYVSAISSGVEKIYWY
DMVNDGVRNDYNEDNFGLLRNAADPLGAFTPKPAYAAYAVMTRELTNWQFHEEESLEPDL
KSYLFMDGGQNNKRVVWSLEPVSAVIKTNQSVEITDMMGNTRTYAPTNGHIYVTLTGEPI
YIKGNIQTINKDATFTVSGGGALSGEPVTFQVEMNNTTAQTLDFILEVEDQSYALNAAPG
QTKLQSVVVNGLDETGTRIVKGVLKSGGQAIGLLQYAAAVDSSETLQIRPVMNGNEPLSQ
SIKVQIRNHSKINALPVHRIDWQLGALLGNQEVNQVLQPDSIGTFDIALQNFELGKSFTA
NIKVAYGNNKTYVYKGNIDFNPVYSGTLNVDGNPDPLIVAKAPTIDLSKGNVKMSGYQGA
DDLSGSVWLNYDNDYFYLTAKVKDNIHAYPATDVNMWNNDSIQFAISNGLPGEDSNYYEY
GISQTAAGSQIYRWIAPIGIAKGWVLNGEVRVARDEAQKLTTYELALPWSELAPITTESG
VFNFSLLVNDNDGNQRKGYIEWGGGIGDGKAPSKFRSMQWIQE

Enzyme Prediction     

No EC number prediction in MGYG000001542_02360.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	439	714	7.3e-21	0.6728538283062645
CBM9	991	1167	2.4e-18	0.9120879120879121

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	6.45e-53	1016	1175	21	183	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
NF033679	DNRLRE_dom	1.17e-22	45	201	1	163	DNRLRE domain. The DNRLRE domain, with a length of about 160 amino acids, appears typically in large, repetitive surface proteins of bacteria and archaea, sometimes repeated several times. It occurs, notably, three times in the C-terminal region of the enzyme disaggregatase from the archaeal species Methanosarcina mazei, each time with the motif DNRLRE, for which the domain is named. Archaeal proteins within this family are described particularly well by the currently more narrowly defined Pfam model, PF06848. Note that the catalytic region of disaggregatase, in the N-terminal portion of the protein, is modeled by a different HMM, PF08480.
cd00241	DOMON_like	4.08e-16	1010	1162	5	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd09619	CBM9_like_4	2.81e-14	989	1158	3	167	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00005	CBM9_like_1	1.53e-06	983	1175	4	179	DOMON-like type 9 carbohydrate binding module of xylanases. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. The CBM9 domain frequently occurs in tandem repeats; members found in this subfamily typically co-occur with glycosyl hydrolase family 10 domains and are annotated as endo-1,4-beta-xylanases. CBM9 from Thermotoga maritima xylanase 10A is reported to have specificity for polysaccharide reducing ends.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS16815.1	0.0	1	1183	3	1185
SMF84368.1	0.0	24	1181	31	1193
AZS14136.1	0.0	42	1181	70	1208
QNK56522.1	0.0	38	1181	330	1481
AZS14129.1	9.14e-285	279	1183	358	1266

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JVK_A	7.20e-29	355	782	62	496	Structuralinsights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_B Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus],5JVK_C Structural insights into a family 39 glycoside hydrolase from the gut symbiont Bacteroides cellulosilyticus WH2. [Bacteroides cellulosilyticus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.044528	0.671932	0.279836	0.002728	0.000606	0.000346

TMHMM  Annotations     

start	end
9	31