CAZyme Information: MGYG000001542_02415

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_02415
• CAZy Family: GH48
• CAZyme Description: Exoglucanase-2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
995	MGYG000001542_33|CGC2	108965.61	4.2793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 110648; End: 113635 Strand: -

Full Sequence      

MKSTVFQKTASIVMTAALLVSLMTGAFGLGANKASAASLEETRFLQLYAQIKDPSNGYYS
AEGIPYHAIETLMSEAPNYGHMTTSEAYSYWMWLEVLYGYYTEDWSKLEAAWDNMETYII
PINEGDGVQEQPTMNYYDPNSPATYAAEYAQPDQYPSQLSGQYSPGKDPLDAELKATYGN
NQTYLMHWLVDVDNWYGYGNLLNPSHTAAYVNTFQRGEQESVWEAVSHPSQDDKTFGKSG
EGFMTLFTKESNAPAAQWRYTNATDADARAIQAMYWAKELGYDNEVYLQKAEKMGDYLRY
GMYDKYFQKIGSAANGIPSAGTGKDASHYLMAWYTAWGGGLGQTGNWAWRIGASHAHQGY
QNVVAAYALSDPDGGLIPASPTAGQDWATSLSRQLEFYTWLQSSEGAIAGGATNSWNGSY
AAYPAGASTFYEMAYDEAPVYHDPPSNNWFGMQAWPVERIAELYYILASNGDTSSANFQM
AKQITQKWVDWSLDYVFVNERPVTDGEGYYLDGQGIRVLGGSNPQIATVSAPGEFWIPSN
LEWQGKPDSWNGLGSYTGNPNLHVTVNNPGQDVGVLGSYIKALTFFAAATKAENGNDIGL
GSQAEQAAKSLLDTAWAYNDGIGITTSEPRADYYRYFTKEIYFPNGWSGTFGQGNTIPGS
NTVPSDPAKGGNGVYASYIDVLPNIQNDSSWPYLLNKYNTSWNPSTQKWENGAPEFTYHR
FWAQVDMATAYAEYDRLIQGGGSGPVEPTAPKAPANPKANAGDAKIDLSWSKASGADSYT
VHRATVSGGPYTAIATITGTSYTDTSVVNDTTYYYVISAVNAIGESPYSAEVSATPKAIP
VPAAGDLVLQYRTNDTNPNDNQIRAQFRIVNNGDTPIALSNVKFRYYYTIDGDKPQEFHC
DYAALGSGNIIGNFVKLNSPAAGADYYLEVSFGPGAGTLAPGANTGEIQVRFNKTDWSNY
AESDDYSYDATQSNYADWERVPVYLNGALVFGLEP

Enzyme Prediction     

EC	3.2.1.176	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH48	42	500	2.6e-205	0.7332242225859247
CBM3	850	931	6.2e-28	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02011	Glyco_hydro_48	0.0	43	737	4	619	Glycosyl hydrolase family 48. Members of this family are endoglucanase EC:3.2.1.4 and exoglucanase EC:3.2.1.91 enzymes that cleave cellulose or related substrate.
pfam00942	CBM_3	4.52e-26	849	930	1	82	Cellulose binding domain.
smart01067	CBM_3	1.49e-22	849	931	1	83	Cellulose binding domain.
cd00063	FN3	4.93e-07	751	835	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
COG3401	FN3	8.34e-05	746	870	160	274	Fibronectin type 3 domain [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZK49112.1	0.0	1	995	1	996
ASA26471.1	0.0	1	995	1	994
APB78411.1	0.0	2	995	4	995
APQ62118.1	0.0	2	995	4	995
ALA44829.1	0.0	2	995	4	995

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7KW6_A	0.0	41	738	4	701	ChainA, Exoglucanase-2 [Bacillus licheniformis]
5BV9_A	0.0	43	738	6	700	TheStructure of Bacillus pumilus GH48 in complex with cellobiose [Bacillus pumilus SAFR-032],5CVY_A The Structure of Bacillus pumilus GH48 in complex with cellobiose and cellohexaose [Bacillus pumilus SAFR-032],5VMA_A Structure of B. pumilus GH48 in complex with a cellobio-derived isofagomine [Bacillus pumilus]
6D5D_A	1.14e-217	43	738	23	642	Structureof Caldicellulosiruptor danielii GH48 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
4EL8_A	2.49e-216	43	738	12	631	Theunliganded structure of C.bescii CelA GH48 module [Caldicellulosiruptor bescii DSM 6725]
4L0G_A	5.29e-216	43	738	16	635	CrystalStructure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4L6X_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725],4TXT_A Crystal Structure of a GH48 cellobiohydrolase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50900	6.05e-263	43	995	43	914	Exoglucanase-2 OS=Thermoclostridium stercorarium (strain ATCC 35414 / DSM 8532 / NCIMB 11754) OX=1121335 GN=celY PE=1 SV=2
P50899	3.27e-216	43	840	62	792	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
P22534	5.50e-202	43	738	1120	1739	Endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celA PE=3 SV=2
P37698	6.58e-200	6	742	5	660	Endoglucanase F OS=Ruminiclostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) OX=394503 GN=celCCF PE=1 SV=2
P0C2S5	9.65e-199	7	730	4	653	Cellulose 1,4-beta-cellobiosidase (reducing end) CelS OS=Acetivibrio thermocellus OX=1515 GN=celS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000494	0.998138	0.000674	0.000281	0.000218	0.000173

TMHMM  Annotations     

start	end
9	31