CAZyme Information: MGYG000001542_02509

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_02509
• CAZy Family: GH94
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
910		102827.81	5.2133

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 216477; End: 219209 Strand: +

Full Sequence      

MKARGWQYAGKQGEFKLEQPESYSYLYFPLVNEAGMMSSITPNLHGQITTGHNSFLTEPV
SAETLHNSKAARNFWIYTEKEGAWSVSGNSARQNAQQFARGREYSQMEAGFLWHRITRRH
GMLPLTAETTNFVPVTEDQVELMKVKLTNTGDTPVRFTATAAIPLYGRSADDLRDHRHVT
SLLHRIYTSTYGIEVQPSLSFDERGHRVNKVTYSVLGAEAQGRRPSGFFPVIEDFIGEGG
ALDWPEAVVLNREAQAGPDVHLEGYEAVGGLRFEEVELGAGESKSYIIAMLITGERVNGE
EYAAKYLSEVSFDKLLAQNEGYWREKLDTIIFHSGDEEQDLWLRWVTLQPVLRRLYGNSF
LPYHDYGRGGRGWRDLWQDCLALMVMEPAEVRYLLLNNYAGVRTDGSNATIIGAKPGEFI
ADRNNIPRVWMDHGAWPLLTTMLYIHQSGDLDFLLQSQTYFRDSFIQRSKGRDTNWLPEQ
GNKLLTREGDIYEGTILEHILLQNLVPFFNVGEHNNIKLEGADWNDGLDLAPNRGESVAF
TAFYASNLLDLSDLLLQLKQRSGINTIQLGQEIAGLLDSLSHPVSYDSTTSKLALLDSYY
QSIVPAVSGKLVELSIEDVAQDLRLKAEWMITHLRRNEWVTSQEGYEWFNGYYNNDGERV
EGDDPEGVRMTLTGQVFTIMGGVATDEQVDKIHAAVERYLKDERIGYRLNSRFGGIQQNL
GRAFGFAFGHKENGAMFSHMTVMYANALYKRGYVQEGHQVLDSIYRLSSDFALSKMYPGV
PEYINERGRGMYTYLTGSASWLLLTQLTEVYGVKGYYGDLLLEPKLMRAQFDAEGAASVE
TLFAGRMLEVVYHNPQQIDYGQYRIGAVKINGQQTDLKMSGRGCLISRELLDVLPKQGNQ
VIEVLLERIS

Enzyme Prediction     

EC	2.4.1.31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	72	876	1.9e-145	0.6611969111969112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11749	GH94N_LBP_like	8.99e-126	74	302	1	229	N-terminal-like domain of Paenibacillus sp. YM-1 Laminaribiose Phosphorylase and similar proteins. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes bacterial laminaribiose phosphorylase. This N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. Bacterial laminaribiose phosphorylase phosphorolyzes laminaribiose into alpha-glucose 1-phosphate and glucose, but does not phosphorolyze other glucobioses; it slightly phosphorolyzed laminaritriose and higher laminarioligosaccharides. The GH64N domain, as represented by this model, is also found at the N-terminus of GH94 members with uncharacterized specificities.
COG3459	COG3459	4.40e-33	86	826	349	995	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
cd11746	GH94N_like	1.29e-22	83	290	11	177	N-terminal domain of glycoside hydrolase family 94 and related domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-), amongst other members. Their N-terminal domain is involved in oligomerization and may play a role in catalysis, but it is separate from the catalytic domain [an (alpha/alpha)(6) barrel]. This GH64N domain also occurs in tandem repeat arrangements (not at the N-terminus) in cyclic beta 1-2 glucan synthetase and related proteins, and as a standalone domain in distantly related proteins of unknown function.
pfam17167	Glyco_hydro_36	1.22e-19	322	814	1	425	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
pfam06165	Glyco_transf_36	3.93e-06	84	294	62	247	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS16671.1	0.0	1	909	1	908
BAJ10826.1	0.0	1	908	1	908
AZK48182.1	0.0	1	908	1	908
AVV57046.1	0.0	1	904	1	905
ANA79038.1	0.0	1	904	1	905

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GGY_A	0.0	1	908	3	910	Paenibacillussp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GGY_B Paenibacillus sp. YM1 laminaribiose phosphorylase with sulphate bound [Paenibacillus sp. YM1],6GH2_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH2_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-glc-1-phosphate bound [Paenibacillus sp. YM1],6GH3_A Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1],6GH3_B Paenibacillus sp. YM1 laminaribiose phosphorylase with alpha-man-1-phosphate bound [Paenibacillus sp. YM1]
3RRS_A	1.39e-10	128	826	116	761	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	5.46e-10	128	826	116	761	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	3.48e-10	226	826	2253	2783	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q7S0S2	4.52e-08	663	858	557	769	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000029	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_02509.