CAZyme Information: MGYG000001542_03254

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_03254
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419	MGYG000001542_37|CGC2	47739.75	4.6285

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 229564; End: 230823 Strand: +

Full Sequence      

MNNELKKQPTDYVMALPTPEQLAWQDKELGLFCHFGMNTFCDQEWGEGNDSPTLFNPTEL
DARQWVRTAKEAGFRYFVLTAKHHDGFCLWPTSTTDYSVASSPWKNGQGDVVRECANACR
EEGVGFGIYVSPWDRHEPCYSDPQKYDDFYCRQLEELLTGYGPLVEIWFDGAGSEGREYD
WRRIIGLVKQHQPEAMIFNMGAPTIRWVGNEDGLAPYPCWNTAKTAKGSMFSEASLQWLP
ETPDWVPAECDVPIRKDHWFWHPNDESSLLTLEQLMDIYYRSVGHGATLLLNVSPDDRGL
LPEIDAKRLLELGEEIRRRFSHPLAETGGSGELLELELVEAALIDHVVLMEDIAYGERVR
QYVLEVHADGEWKELVHGSAIGHKKIDVLTPVNADKIRLRLTESVGNPIIRKFAVYSSQ

Enzyme Prediction     

No EC number prediction in MGYG000001542_03254.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	7	314	6e-85	0.8872832369942196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3669	AfuC	4.76e-78	13	416	7	430	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	1.03e-42	17	314	8	326	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	2.09e-41	17	314	9	328	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS15924.1	0.0	1	419	1	419
ACX64914.1	1.52e-257	1	416	1	415
AYB44793.1	2.03e-250	14	416	11	413
AIQ34539.1	1.03e-249	15	416	15	416
QOT12691.1	1.17e-249	14	416	11	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	2.25e-123	16	419	31	461	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
5K9H_A	1.41e-107	16	416	38	463	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
6ORG_A	4.04e-96	16	418	10	450	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
3GZA_A	4.38e-96	14	417	7	441	Crystalstructure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482],3GZA_B Crystal structure of putative alpha-L-fucosidase (NP_812709.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.60 A resolution [Bacteroides thetaiotaomicron VPI-5482]
6OR4_A	6.20e-95	16	418	10	450	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	3.40e-111	13	416	34	477	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	1.06e-109	13	417	36	477	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P49713	4.27e-21	24	313	34	339	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q6AYS4	2.84e-16	23	313	40	349	Plasma alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca2 PE=2 SV=1
Q99KR8	6.87e-16	24	313	72	351	Plasma alpha-L-fucosidase OS=Mus musculus OX=10090 GN=Fuca2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000034	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_03254.