CAZyme Information: MGYG000001542_03308

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_03308
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1167	MGYG000001542_37|CGC3	132310.38	4.8741

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 292342; End: 295845 Strand: -

Full Sequence      

MSQNTKFNNDWFFAKMPLHTKLETVLSGSISWSSVTLPHDWLIYDTHHLYESGEGWYHKT
LLLNELVPNNYMSLCFEGVYMDSSLYVNGHLAGTWKYGYSTFEIDITPYITSGSNEIYVR
VVHESPNSRWYSGAGIYRNVWLKTYSEAHIVPYGVYISAQKQQDDSGSWTVEIDTELRLR
EVSSPAAMRKTMIQHTIRDEADVKIAQIETEVAWEDGQTVPIPSSISVRRPILWDLSQPY
CYTLKTELFVENKLVDTEINRFGFRTMEFDSQRGFFLNSQPVKLHGVCQHHDLGCLGAAV
NKAALQRQISLLQEMGVNAIRTAHNMPAVELMELADQMGVLIVSEAFDIWERPKTTYDYA
RFFPEWWKKDVASWIRRDRNHPSMLMWSIGNEIYDTHADERGQELTRLLRDEVLLHDPKT
NAVITIGSNYMPWENAQKCADLVRFAGYNYGEKYYDLHHKEHPDWIIYGSETSSTVQSRG
IYHFPLSQSVLSDDDEQCSSLGNSSTSWGAKSTERCIMDDRDAVYSPGQFIWTGFDYIGE
PTPYHTKNSYFGQLDTAGFKKDSFYIYQAEWTDYKVSPMVHIFPYWDFSTGQMIDVRVCS
NAPRIELFFNEVSQGIVDIDHKYDHKLLGEWRIPYQKGVLQAVAYDENGAPIATDMRSSF
GDAASLVMMPDRNTITADGSDLIFIEISAVDQDGIPVENANNRVHITVEGSGRLVGLDNG
DSTDYDQYKGTNRRLFSGKLLAVIASTAETGSIRVHAESRGLNPAELVLMATPPQPSKGI
AHELSLYSYTNANAEELESQALSKTHELLTSEIPIRKLEIICPAGNQLSKDNRSLPVRVQ
IHPSNATYQEVQWRVTNAGGIDANIAALDANGHEAVITALGDGDVYIRCAATNGSDHIRL
YALMEFHISDLGQACLNPYEFVSAGYHSESSLNLTNGNDRGVATGRDGESRICFDKIDFG
SFGSDEITLPIFSLDDTEFPIEIWEGIPGEANAALLTTVTYQKQSIWNVYQEETYRLPRR
LKGVTSLCFLLRRKIHLKGFKFKKPMKAFEPLSVLENDRIYGDSFALTEDSIEKIGNNVS
LVFEDMDFGEAGSNKLVICGHSPLDMNTLHIQFSGQDGDSRQIVEFAYSDDYCEREFILE
RITGFQTVTFVFLPGSQFDFKWFQFHR

Enzyme Prediction     

EC	3.2.1.8	3.1.1.73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	550	2.4e-100	0.5944148936170213

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	8.71e-63	51	587	80	614	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	5.96e-40	53	392	65	417	beta-D-glucuronidase; Provisional
pfam18565	Glyco_hydro2_C5	1.43e-39	666	768	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10340	ebgA	9.15e-32	55	392	111	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam16355	DUF4982	1.90e-20	591	655	1	62	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV33722.1	0.0	1	1165	1	1156
AIQ74402.1	0.0	1	1165	1	1156
QKS44447.1	0.0	1	1165	1	1156
ANS74671.1	0.0	1	1165	1	1153
CQR57247.1	0.0	1	1165	1	1154

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7CWD_A	1.71e-185	7	772	6	802	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
4YPJ_A	3.74e-182	3	774	8	810	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
4CU6_A	2.45e-151	7	759	18	832	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
4CUC_A	6.71e-151	7	759	18	832	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
5T98_A	4.66e-150	1	769	24	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	5.13e-157	3	771	43	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.14e-88	5	749	49	798	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.41e-51	8	644	57	702	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	8.94e-47	7	759	8	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KN75	8.63e-43	7	796	31	819	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_03308.