CAZyme Information: MGYG000001542_03476

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_03476
• CAZy Family: PL31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
604		63548.78	4.9205

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 161825; End: 163639 Strand: +

Full Sequence      

MSSSIRNIHSLFYKLGLCLLVLVLGLSFTETMAMASPVTLSPIGDSYVHQGNSSSNYGAS
TSLYVKNDTASSRQAFLKFNLSGISNVTSAKLRIYGSSSYNTVLSAYQTADNWNESTITW
NNKPVQGSLAGSVPMNTTAVYYELDVTGYVAAEAAGDGIVSFMLQESAGKYTTLNSREKG
VNGPELIISGSSTHPGGNEQPPAAPTHVTGVATSGTQIQLSWSPAEASGGVAGYEVFRNG
NLAADTAGVFFLDSALDSDTLYSYYVIARDSAGNRSAPSSTVMVRTLADSGSTPVCSSAL
NSAVAIQNAMRTAMPGDIIAIAPGTYTGVKATSGDPGGQGLFYSGQNGTEAAPILLTSCD
PDNPAVLKGTSVNDGSYGIHLTGDYWQIRNMEIDTAQKGIVIDHGNNNLLHGLKIHQIGD
EGVHFRDGSSYNRLEYSTIYNTGKYQPGYGEGAYVGSDSSSNYEHLVYDNVISHTIFDGG
ITAEHIDIKEGASGTIVEYCTFNGTGISGANSADSFIDVKGVNTIVRYNQGYRNGNANIT
DAFQVRTHGTAYPTGQNNSFDHNTVHLDDSAGYVVYATGAAAGTTAHDDVRIGGGNLYNN
NVNK

Enzyme Prediction     

No EC number prediction in MGYG000001542_03476.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL31	307	502	7.6e-63	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
NF033679	DNRLRE_dom	4.85e-26	45	188	2	163	DNRLRE domain. The DNRLRE domain, with a length of about 160 amino acids, appears typically in large, repetitive surface proteins of bacteria and archaea, sometimes repeated several times. It occurs, notably, three times in the C-terminal region of the enzyme disaggregatase from the archaeal species Methanosarcina mazei, each time with the motif DNRLRE, for which the domain is named. Archaeal proteins within this family are described particularly well by the currently more narrowly defined Pfam model, PF06848. Note that the catalytic region of disaggregatase, in the N-terminal portion of the protein, is modeled by a different HMM, PF08480.
cd00063	FN3	1.60e-07	202	286	1	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
COG3979	COG3979	4.91e-05	198	377	1	181	Chitodextrinase [Carbohydrate transport and metabolism].
smart00060	FN3	4.14e-04	202	273	1	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
cd14251	PL-6	4.28e-04	301	538	2	240	Polysaccharide Lyase Family 6. Polysaccharide Lyase Family 6 is a family of beta-helical polysaccharide lyases. Members include alginate lyase (EC 4.2.2.3) and chondroitinase B (EC 4.2.2.19). Chondroitinase B is an enzyme that only cleaves the beta-(1,4)-linkage of dermatan sulfate (DS), leading to 4,5-unsaturated dermatan sulfate disaccharides as the product. DS is a highly sulfated, unbranched polysaccharide belonging to a family of glycosaminoglycans (GAGs) composed of alternating hexosamine (gluco- or galactosamine) and uronic acid (D-glucuronic or L-iduronic acid) moieties. DS contains alternating 1,4-beta-D-galactosamine (GalNac) and 1,3-alpha-L-iduronic acid units. The related chondroitin sulfate (CS) contains alternating GalNac and 1,3-beta-D-glucuronic acid units. Alginate lyases (known as either mannuronate (EC 4.2.2.3) or guluronate lyases (EC 4.2.2.11) catalyze the degradation of alginate, a copolymer of alpha-L-guluronate and its C5 epimer beta-D-mannuronate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZS15743.1	0.0	1	604	1	604
QRN99389.1	1.02e-259	39	604	41	604
ADO69469.1	1.39e-259	40	603	42	602
QRK13860.1	1.52e-255	40	604	39	599
ATB42714.1	4.21e-246	39	604	49	611

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KFN_A	2.23e-80	302	603	10	298	Crystalstructure of alginate lyase from Paenibacillus sp. str. FPU-7 [Paenibacillus sp. FPU-7]
1K85_A	2.76e-11	202	286	4	88	ChainA, CHITINASE A1 [Niallia circulans]
1RU4_A	1.55e-10	270	440	2	171	ChainA, Pectate lyase [Dickeya chrysanthemi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	2.72e-13	127	303	475	661	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P0C1A6	1.77e-11	266	440	23	196	Pectate lyase L OS=Dickeya chrysanthemi OX=556 GN=pelL PE=3 SV=1
P0C1A7	7.31e-11	266	440	23	196	Pectate lyase L OS=Dickeya dadantii (strain 3937) OX=198628 GN=pelL PE=1 SV=1
A0P8X0	1.65e-08	83	286	690	899	Alpha-amylase OS=Niallia circulans OX=1397 GN=igtZ PE=1 SV=1
P50899	2.74e-08	181	289	777	887	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001155	0.998008	0.000259	0.000191	0.000175	0.000184

TMHMM  Annotations     

start	end
7	29