CAZyme Information: MGYG000001542_04033

Basic Information

• Species: Paenibacillus_A sp900069005
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_A; Paenibacillus_A sp900069005
• CAZyme ID: MGYG000001542_04033
• CAZy Family: CBM3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		40731.85	5.0807

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001542	5846629	Isolate	not provided	not provided

• Gene Location: Start: 58493; End: 59614 Strand: +

Full Sequence      

MHKVVLFGISFYPRCHLYPDHWNKTPEWGTQWMIDHIEAGDAIGKPVVLEEFGYQNQATR
DQVYQTWLSTIEQYNGAGSQFWILTGIQDDNSLYPDYDGFRVIYPSSTATVIQSHALNMN
AKSGTSQPSVPPAPTGLLAKPGNGSATISWHASPGATSYTVQRSDNANGPYTAVAANLTA
TTYLDTGLTNGSTYYYRVNAANSVGASADSASVSVIPKEITVGNLSIQYKAAETGVNNNQ
IRPHFKIKNQGTEAIPYENLTLRYWYTAESNQAQFFDCDYAQLGCTNLSGAVHQLAQPLT
GADHYLEISFASAAGTLAAGGNSGEIMARLHQGDWSNYNQANDYSFLSSARSYTENNHIT
LYDNGVLIWGIEP

Enzyme Prediction     

EC	3.2.1.78

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM3	228	309	2.9e-24	0.9886363636363636

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00942	CBM_3	9.97e-23	227	308	1	82	Cellulose binding domain.
smart01067	CBM_3	2.24e-18	227	309	1	83	Cellulose binding domain.
COG3934	COG3934	1.09e-10	8	103	198	302	Endo-1,4-beta-mannosidase [Carbohydrate transport and metabolism].
cd00063	FN3	3.07e-09	131	216	1	92	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	1.45e-07	131	207	1	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASR46400.1	1.52e-74	123	373	707	957
QMV43204.1	1.09e-73	128	373	37	283
QJD87157.1	1.90e-73	23	373	293	632
AWV32895.1	4.59e-73	42	373	422	770
QMV43202.1	1.78e-70	120	373	94	345

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2L8A_A	3.64e-43	222	373	1	148	Structureof a novel CBM3 lacking the calcium-binding site [Bacillus subtilis],6UFV_A Crystal structure of the CBM3 from Bacillus subtilis at 1.06 angstrom resolution [Bacillus subtilis subsp. subtilis str. 168],6UFW_A Crystal structure of the CBM3 from Bacillus subtilis at 1.28 angstrom resolution [Bacillus subtilis subsp. subtilis str. 168]
6D5B_A	8.07e-41	221	373	15	167	Structureof Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_B Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_C Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_D Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_E Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_F Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_G Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_H Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_I Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_J Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_K Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii],6D5B_L Structure of Caldicellulosiruptor danielii CBM3 module of glycoside hydrolase WP_045175321 [Caldicellulosiruptor danielii]
3ZQW_A	2.34e-37	224	373	5	153	ChainA, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus],3ZU8_A Chain A, Cellulosomal Scaffoldin [Acetivibrio cellulolyticus],3ZUC_A Chain A, CELLULOSOMAL SCAFFOLDIN [Acetivibrio cellulolyticus]
4JO5_A	2.50e-29	223	373	17	172	ChainA, Cellulosome anchoring protein cohesin region [Acetivibrio thermocellus YS]
1NBC_A	7.10e-29	224	373	1	155	ChainA, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus],1NBC_B Chain B, Cellulosomal Scaffolding Protein A [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	2.42e-39	195	373	324	498	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P23549	6.42e-39	195	373	324	498	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P07983	2.27e-37	225	373	354	498	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P10474	2.91e-36	221	373	418	570	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
P22533	5.78e-36	221	373	363	515	Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=manA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999540	0.000503	0.000007	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001542_04033.